DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-11

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_509270.1 Gene:lgc-11 WormBaseID:WBGene00000061 Length:434 Species:Caenorhabditis elegans

Alignment Length:387 Identity:71/388 (18%)
Similarity:138/388 (36%) Gaps:83/388 (21%)


  Fly   211 KEETKTEKLLSHLNIQAENASMPA-NLSS---ISFHFQTRSLA-YEQTSSLLQTRMHMMMHWRDS 270
            |::....:|..||.......:.|. |.||   ::...|..:|. ..:.:..::..:.....|:|.
 Worm    31 KDDRNERELAKHLLDDYYQYTRPVRNYSSVLNVTVQPQIYNLVEVNEQNEQIKILLWFPQSWKDD 95

  Fly   271 RLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLAS 335
            .|.|.|:::..:|....|..:||.|...:.|...::  :.|:::...|..:|.:.:....| :..
 Worm    96 YLTWDPKEWNGIERIIIPKSQIWIPDGYIFNTVEET--EPLENHNARVRYDGRVEVDFNKL-VDL 157

  Fly   336 WCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVE 400
            .|..|..::|.:...|.::.|....:.......:.|    ...|.:..|  |.|.....:..   
 Worm   158 TCPMSVLSFPFDVQLCALQFGSWSYQAHAISFNVLD----TFVPKKSKN--SEWDIVSFNAT--- 213

  Fly   401 NDSQRRYNPKGMMQKMT---GDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRST----- 457
                          |||   ||....|.:.....:|:.:...||....:.|:.||::.:.     
 Worm   214 --------------KMTTKYGDTLGGFNVYEEIFYYLELRRKPLYYIVVILLPSFLIVTVSNIGL 264

  Fly   458 -----------RRSSLILIALLIAAWGLMYMTRYASPHYVP------PMMTAYKVIMMTTTYCYI 505
                       ...||.|..:|..|..|..:|     ..:|      |::..|.:|....:...:
 Worm   265 FTPHGVHGDREEHVSLGLTTMLTMAVILDMVT-----GQMPRSSEGIPLLGMYVLIEFVISVIAV 324

  Fly   506 L--------HICIIWLDLYPPRSKAPGWLVRVINSNVLRCILGLRFSDSTDYCD-----IQE 554
            |        |..:::||..||.     |:.::.:.:   |.:.|...:. |:|.     :||
 Worm   325 LVSVVIIFAHERMLYLDATPPY-----WVCKLFSDD---CKMSLEEIEE-DFCSKPADLVQE 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 40/225 (18%)
lgc-11NP_509270.1 Neur_chan_LBD 36..242 CDD:280998 41/232 (18%)
Neur_chan_memb 249..>336 CDD:280999 16/92 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.