DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and acr-3

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_509129.1 Gene:acr-3 WormBaseID:WBGene00000043 Length:487 Species:Caenorhabditis elegans

Alignment Length:414 Identity:87/415 (21%)
Similarity:161/415 (39%) Gaps:100/415 (24%)


  Fly   154 ELFVYIPGFKKEPLLQFIDEAPLVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEK 218
            ||..| |...:|.||.:|                           ||||.|.|.|::        
 Worm    17 ELQCY-PNSAEERLLSYI---------------------------FDGYNSLIRPVL-------- 45

  Fly   219 LLSHLNIQAENASMPANLSSISFHFQTRSLAY------EQTSSLLQTRMHMMMHWRDSRLVWKPE 277
                      |||.|    .|...|   |||:      ::.:.::||.:...|.|.|.::.|.|.
 Worm    46 ----------NASSP----PIEVFF---SLAFVLLINVDEKNQIMQTNVWPTMKWNDYQMQWDPR 93

  Fly   278 DFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQS-YELMVYANGSITLYAQNLQLASWCVDSA 341
            :|..:::...|..::|.|.:.:.|.|   .|..|.| |..:|..:....|:.......|.|:...
 Worm    94 EFDGIKTIRVPPDKVWLPDIVLFNNA---DGNYLVSFYSNVVVEHTGDMLWVPPAVYKSSCLIDV 155

  Fly   342 RNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSG-WSFTQMSVVLVENDSQR 405
            ..:|.:...|.:..| :....::.:.|.|...::.:..|:::  ||| |.......:|::..|:.
 Worm   156 EFFPFDEQVCSLTFG-SWTFRKDELQLSYLSGKRHVELNDYL--PSGVWDLIDAPGLLIDERSKI 217

  Fly   406 RYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVL--RSTRRSSLILIALL 468
            .|..|               ::|...||..:..:|.:......::.|.|  .|:.:.:|.:..||
 Worm   218 SYQIK---------------IRRKALFYTVILIMPTVLMAFLSMMVFYLPAESSEKITLAISILL 267

  Fly   469 IAAWGLMYMTRYASP-HYVPPMMTAYKVIMMTTTYCYILH-----ICIIWLDLY---PPRSKAPG 524
            .....|:.:::...| ....|:|..|  ::||    :|::     :.:|.:::|   |.....|.
 Worm   268 ALVVFLLVVSKILPPTSSTIPLMAKY--LLMT----FIMNMITIMVSVIIINVYFRGPATHIMPN 326

  Fly   525 WLVRVINSNVLRCILGLRFSDSTD 548
            | |:.:....|..:..:|..:||:
 Worm   327 W-VKTVFLKFLPVLFVMRRPESTE 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 8/37 (22%)
Neur_chan_LBD 212..429 CDD:280998 45/225 (20%)
acr-3NP_509129.1 LIC 5..460 CDD:273305 87/415 (21%)
Neur_chan_LBD 26..226 CDD:280998 56/273 (21%)
Neur_chan_memb 234..456 CDD:280999 25/124 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.