DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-55

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_507870.2 Gene:lgc-55 WormBaseID:WBGene00013746 Length:538 Species:Caenorhabditis elegans

Alignment Length:302 Identity:60/303 (20%)
Similarity:113/303 (37%) Gaps:78/303 (26%)


  Fly   248 LAYEQTSSLLQTRMHMMMH------WRDSRLVWKPEDFGSLESFEHPD---------------LR 291
            |..::.|.:.:.:....||      |.|..|           ||||.:               ..
 Worm   116 LLIQRVSEISEIQSSSTMHILFSQIWHDPGL-----------SFEHEEGAHCLTNLSLSHRMVDN 169

  Fly   292 IWKPHMNVLNGALQSMGQVLQ-----SYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTC 351
            ||.|::.::|    |.|..:.     :..|.::.||::.: ...:.:.|.|......:|.:||.|
 Worm   170 IWLPNVCIVN----SKGSAIHKSPTPNIFLAIFPNGTVWM-NYRVVVESPCEMDFSFFPMDRVMC 229

  Fly   352 D-------IELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNP 409
            .       ..:|        .|.|.:..|.:|:...:.|..|   .|.....|   ::......|
 Worm   230 TTIFESYAFNVG--------KVRLHWKRQGQPVEFIDDVKLP---DFHMTKFV---HEKATFIYP 280

  Fly   410 KGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGL 474
            .|:..::.    |:...:|:..||:...|||.....:...:||.|  .|||....:.|.:::  |
 Worm   281 AGVWDQLN----IKLLFRRSYGFYILQIYLPTYCMVLISWISFWL--DRRSLPARVTLGVSS--L 337

  Fly   475 MYMT-RYASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDL 515
            |.:| :|::.....|.::..|.:.:      .:..||:::.|
 Worm   338 MALTLQYSNVSRSLPKVSYVKGLDL------FMFGCIVYIFL 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 39/214 (18%)
lgc-55NP_507870.2 Neur_chan_LBD 88..295 CDD:280998 38/213 (18%)
LIC 90..532 CDD:273305 60/303 (20%)
Neur_chan_memb 304..>391 CDD:280999 19/81 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.