DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and glc-1

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_507090.1 Gene:glc-1 WormBaseID:WBGene00001591 Length:461 Species:Caenorhabditis elegans

Alignment Length:439 Identity:81/440 (18%)
Similarity:162/440 (37%) Gaps:110/440 (25%)


  Fly   208 PIVKEETKTEKLLSHL-------NIQAENASMPANLSSISFHFQTRS------LAYEQTSSLLQT 259
            ||.:.:|...|:|:||       .::....:....:.|::...:|.|      :.|....:|.::
 Worm    55 PIEQPQTSDSKILAHLFTSGYDFRVRPPTDNGGPVVVSVNMLLRTISKIDVVNMEYSAQLTLRES 119

  Fly   260 RMHMMMHWRDSRL--------------------VWKPEDF--GSLESFEHPDLRIWKPHMNVLNG 302
                   |.|.||                    :|.|:.|  ...::::|   .|.||  |||  
 Worm   120 -------WIDKRLSYGVKGDGQPDFVILTVGHQIWMPDTFFPNEKQAYKH---TIDKP--NVL-- 170

  Fly   303 ALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVA 367
                         :.::.:|:: ||:..:.|...|....:.:|.:...|.|:|          .:
 Worm   171 -------------IRIHNDGTV-LYSVRISLVLSCPMYLQYYPMDVQQCSIDL----------AS 211

  Fly   368 LIYDDQRKPIAPNEH--VNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNR 430
            ..|..:.......||  :....|.|.:..|..|  .::...|........:...:.....|:|..
 Worm   212 YAYTTKDIEYLWKEHSPLQLKVGLSSSLPSFQL--TNTSTTYCTSVTNTGIYSCLRTTIQLKREF 274

  Fly   431 SFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYAS--PHYVPPMMTAY 493
            |||:...|:|  :| |.:|:|:|.....|:: |...:.:....|:.||..::  ...:|| ::..
 Worm   275 SFYLLQLYIP--SC-MLVIVSWVSFWFDRTA-IPARVTLGVTTLLTMTAQSAGINSQLPP-VSYI 334

  Fly   494 KVI------MMTTTYCYILHICI---------IWLDLYPPRSKAPGWLVRVINSNVLRCILG--- 540
            |.|      .||..:|.:|...:         :.......|.||...|::.::::|...:..   
 Worm   335 KAIDVWIGACMTFIFCALLEFALVNHIANKQGVERKARTEREKAEIPLLQNLHNDVPTKVFNQEE 399

  Fly   541 ------LRFSDSTDYCDIQE--NPWHHMAKILNNLSSILVIITFAIVDI 581
                  |.......:.::.|  ..|:.::|.::.:|..|..:.|.:.:|
 Worm   400 KVRTVPLNRRQMNSFLNLLETKTEWNDISKRVDLISRALFPVLFFVFNI 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 43/254 (17%)
glc-1NP_507090.1 Neur_chan_LBD 64..273 CDD:280998 42/249 (17%)
LIC 65..452 CDD:273305 78/430 (18%)
Neur_chan_memb 281..451 CDD:280999 33/174 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.