DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and avr-15

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001024076.1 Gene:avr-15 WormBaseID:WBGene00000233 Length:657 Species:Caenorhabditis elegans

Alignment Length:451 Identity:83/452 (18%)
Similarity:162/452 (36%) Gaps:126/452 (28%)


  Fly   208 PIVKEETKTEKLLSHLNIQ---------AENASMPANLSSISFHFQTRSLA-YEQTSSLLQTRMH 262
            ||.:.:|...::|.||..:         .|:.::......:|.:...||:: .:..:.....::.
 Worm   243 PIEQPQTSDTEILEHLLTRGYDHRVRPPGEDGTIHGGPVVVSVNMLLRSISKIDNVNMEYSVQLT 307

  Fly   263 MMMHWRDSRL--------------------VWKPEDF--GSLESFEHPDLRIWKPHMNVLNGALQ 305
            ....|.|.||                    :|.|:.|  ...::::|   .|.||  |||     
 Worm   308 FRESWVDKRLSFGVKGDAQPDFLILTAGQEIWMPDSFFQNEKQAYKH---MIDKP--NVL----- 362

  Fly   306 SMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIY 370
                      :.|:.:|:| ||:..:.|...|....:.:|.:...|.|:|...... .:::..::
 Worm   363 ----------IRVHKDGTI-LYSVRISLVLSCPMHLQYYPMDVQQCFIDLASYAYT-TKDIEYVW 415

  Fly   371 DDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFT---LQRNRSF 432
            .::..       |...:|.|.:..|..|. |.|......|    ..||..:...|   |:|..|:
 Worm   416 KEETP-------VQLKAGLSSSLPSFQLT-NTSTTYCTSK----TNTGSYSCLRTIIQLRRQFSY 468

  Fly   433 YMTVFYLPLIACQMFLI--LSFVLRSTRRSSLILIALLIAAWGLMYMTRYAS--PHYVPPMMTAY 493
            |:...|:|  :|.:.::  :||.:..|...:.:.:.:..    |:.||..:|  ...:||:  ||
 Worm   469 YLLQLYIP--SCMLVIVSWVSFWIDRTAVPARVTLGVTT----LLTMTTQSSGINAKLPPV--AY 525

  Fly   494 -KVI------MMTTTYCYILHICIIWL------------------------------DLYPPRSK 521
             |.|      .||..:|.:|...  |:                              |::.||..
 Worm   526 IKAIDVWIGACMTFIFCALLEFA--WVTYIANKQDANKRARTEREKAELPFLQNSHNDVWVPREV 588

  Fly   522 APGWLVRVINSNVLRCILGLRFSDSTDYCDIQENPWHHMAKILNNLSSILVIITFAIVDIT 582
            |..      ...|:...:..|.::|.......:..|:..:|..:.:|.::..:.|...:|:
 Worm   589 AEQ------EREVMTVRMNRRQTNSVWKWIKTKTEWNDKSKRADLISRVMFPVLFLTFNIS 643

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 46/252 (18%)
avr-15NP_001024076.1 Neur_chan_LBD 252..465 CDD:280998 45/247 (18%)
LIC 253..648 CDD:273305 80/442 (18%)
Neur_chan_memb 473..645 CDD:280999 33/188 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.