DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-44

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_505954.2 Gene:lgc-44 WormBaseID:WBGene00009790 Length:618 Species:Caenorhabditis elegans

Alignment Length:586 Identity:98/587 (17%)
Similarity:200/587 (34%) Gaps:194/587 (33%)


  Fly    86 MDAHILLSVTNHPRPNDRVYEIVIGAGGNTFSAIRNAMGMRRV-----------------ATNQE 133
            :||  |....|:..|  .|.|:|:   .|...|..||:|:.::                 ::|.:
 Worm   132 LDA--LCQTYNYSDP--EVQELVL---NNYEEAQENAIGIDQLLFLDHQSVMIVMPAACNSSNSD 189

  Fly   134 PNLVS----------------------------LYDPTPIEIVQNQNGELFVYIPGFKKEPLLQF 170
            ...:|                            ::|..|::.:.|||..|....| .....:|.|
 Worm   190 EKEISKQYYLEKYGDFSFNVSNLNIELDKLHEMVHDFKPLDQIMNQNLGLDYQRP-LPSSTILPF 253

  Fly   171 IDEAPLVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVK-EETKTEKLLSHLNIQAENASMPA 234
            :.:..                          |.:...|.:. ::|.|.|    :.|..::.|   
 Worm   254 LRKME--------------------------YDARQPPSLHVDDTVTVK----VGIAVQSMS--- 285

  Fly   235 NLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRL---VWKP---EDFGSLESFEHPDLRIW 293
                   :|:..::.|:..:       .:.|.|.|.||   :.:|   .|:..|:       .||
 Worm   286 -------NFELSTMDYDLDA-------WVRMSWIDPRLRHDLSRPILVNDYTFLK-------MIW 329

  Fly   294 KPHMNVLNGALQSMGQVLQ-SYELMVYANGSITL--------YAQNLQLASWCVDSARNWPSERV 349
            :|.....|....:..:|.. ::.|.::.:|.|.:        .|..:.|..:..|:    |:   
 Worm   330 RPDPIFTNSKYSTFHKVTYLNFYLFIFPDGKIFMDMRVYLKPTAAQIVLCKYPHDN----PA--- 387

  Fly   350 TCDIELGLNGQEGQENVALI--YDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGM 412
               :.|.::.....::|..:  :.|....|...::|..|      ::|:..:..|:.......|:
 Worm   388 ---VSLKISSMGFTQDVVKLEWFSDTNDAIWIEKNVKIP------ELSIRHLHPDTCNGVRKSGV 443

  Fly   413 MQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYM 477
            ...:..    :|.:.|...:::...|:|...|.:|..:|..|........|.::|.:      ::
 Worm   444 YSCLEA----KFYMHREVGYHIANTYIPTAICVVFSWISVWLPEEFVEGRIFVSLTV------FL 498

  Fly   478 TRYASPHYVP---PMMTAYKVIMM----TTTYCYIL---HICIIWLDLYPPRSKAPGWLVRVINS 532
            |..|..:...   |.::..|.|.:    |:|:.::.   .:.:|.|:               .||
 Worm   499 TLSAENNSAKEELPKVSYVKAIDIWFGFTSTFVFLTMLQALVVISLE---------------HNS 548

  Fly   533 NVLRCILGLRFSDSTD-YCDIQ-------ENPWHHMAKILNNLSSI------LVIITFAIVDITS 583
            ..||    |:|.::.| |...|       ...:|.||:.::....:      |:.:.|.:..||.
 Worm   549 KRLR----LKFENNLDGYSKYQMTKSMLLSRYYHRMARQIDTFCKVMYPVIFLLFLMFYVFVITQ 609

  Fly   584 G 584
            |
 Worm   610 G 610

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 22/146 (15%)
Neur_chan_LBD 212..429 CDD:280998 38/234 (16%)
lgc-44NP_505954.2 Neur_chan_LBD 259..>417 CDD:280998 33/196 (17%)
Neur_chan_memb 464..>550 CDD:280999 19/107 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.