DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and des-2

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001256321.1 Gene:des-2 WormBaseID:WBGene00000955 Length:559 Species:Caenorhabditis elegans

Alignment Length:377 Identity:70/378 (19%)
Similarity:124/378 (33%) Gaps:98/378 (26%)


  Fly   208 PIVKEETKTEKLLSHLNIQAE---NASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRD 269
            |:..:......||.:.:.:|:   :.|.|.|:|.....:|...|...|...||..  .::..|.|
 Worm    22 PVPTQIRLVHDLLDNYDKKAKPMWDNSKPINVSFSMDLYQILELNEPQQYILLNA--WIIERWFD 84

  Fly   270 SRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSIT--------- 325
            ..|.|.|:|:.::.....|...||.|...:.|..      |::..:.....|..:|         
 Worm    85 EFLYWNPDDYENITELRLPYDSIWLPDTTLYNSL------VMKDDDTRRLLNSKLTTDTHRRAAL 143

  Fly   326 ---LYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAP-NEHVNTP 386
               ||....:.:  |:...|.:|.:...|.:...          :..||.:.....| ::.:.|.
 Worm   144 IELLYPTIYKFS--CLLDLRFFPFDVQVCTMTFS----------SWTYDQKGIDYFPYSDKIGTS 196

  Fly   387 S-----GWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQM 446
            :     ||...|..:...|.......|...::|       :...|:|...||:....:|.....:
 Worm   197 NYLENEGWYILQTKIKRQEVKYACCPNNYTLLQ-------LTLYLRRKPLFYLVNLIIPTSIITL 254

  Fly   447 FLILSFVLRST----RRSSLIL-IALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYCYIL 506
            ..|:.|...|:    |...:.| |..|::...||.|.....|              .|:|:..::
 Worm   255 IAIVGFFTTSSASGMREEKVSLGITTLLSMSILMLMVSDQMP--------------TTSTFIPLI 305

  Fly   507 HICIIWLDLYPPRSKAPGWLV----------RVINSNVL----RCILGLRFS 544
                             ||.:          .|::|.::    |..||.|.|
 Worm   306 -----------------GWFILAMIIVISLGTVVSSVIIAIQKRGSLGERMS 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 44/238 (18%)
des-2NP_001256321.1 Neur_chan_LBD 28..222 CDD:280998 40/214 (19%)
Neur_chan_memb 245..>363 CDD:280999 23/128 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.