DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-49

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_505841.2 Gene:lgc-49 WormBaseID:WBGene00010741 Length:457 Species:Caenorhabditis elegans

Alignment Length:427 Identity:83/428 (19%)
Similarity:148/428 (35%) Gaps:114/428 (27%)


  Fly   217 EKLL-----SHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKP 276
            :|||     :...|..|| .:|.   .:.|..|..:...|.|:. .:..:::...|.|..|    
 Worm    59 DKLLNGTGYNKFRIPNEN-GVPV---QVEFWVQAITSINEITND-FEMDIYINEMWLDPAL---- 114

  Fly   277 EDFGSLE------SFEHPDL-RIWKPHMNVLNGALQSM-GQVLQSYELMVYANGSITLYAQNLQL 333
             .|..|.      |..|..| ::|.|:...:|.....: ....::..||:|.||::         
 Worm   115 -KFDHLNPCKQNLSVSHQVLEQLWTPNSCFVNSKFAEIHDSPFKNVFLMIYPNGTV--------- 169

  Fly   334 ASWCVDSARNWPSERVT----CDIELGLNGQEGQENVALIYDD---------------QRKPIAP 379
                      |.:.||.    ||:.|.|...:.|| ..|||:.               ..:|::.
 Worm   170 ----------WVNYRVNVKGPCDLSLELFPLDIQE-CHLIYESFNYNNQEVRMRWNEKSAEPVSV 223

  Fly   380 NEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIAC 444
            ...:..|      ...::.:|:.......|.||..    ::.::...:|...:|....|||....
 Worm   224 TNKIRLP------DFELIKIESTRISAPYPAGMWD----ELHVKLVFERRYIWYFMQAYLPTYLT 278

  Fly   445 QMFLILSFVLRS---TRRSSLILIALL--IAAWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYCY 504
            .....:||.|.:   ..|:.|.:.|||  |..:|.: |.......|| ..:..:.::.||..:..
 Worm   279 IFISWISFSLGTKAMPARTMLGVNALLAMIFQFGNI-MRNLPRVSYV-KAIDVWMLVSMTFIFLS 341

  Fly   505 ILHICII------------------WLDLYPPRSKAPGWLVRV-------INSNVLRCILGLRFS 544
            :|.:.|:                  .||.:   ..:|..|.|.       :.....|....:||.
 Worm   342 LLELAIVGYKTKNEEGSKKKCPHKKLLDNF---EASPAGLCRYEKRFMLPVERRSARWGGIIRFQ 403

  Fly   545 DSTDYCDIQENPWHHMAKILNNLSSILVIITFAIVDI 581
            ...|:       |:...:.::.:|:|:....|||.:|
 Worm   404 VFQDF-------WNWSPEKIDRVSAIMFPACFAIFNI 433

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 46/244 (19%)
lgc-49NP_505841.2 LIC 53..439 CDD:273305 83/428 (19%)
Neur_chan_LBD 57..264 CDD:280998 46/245 (19%)
Neur_chan_memb 272..436 CDD:280999 36/175 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.