DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and mod-1

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_741580.1 Gene:mod-1 WormBaseID:WBGene00003386 Length:489 Species:Caenorhabditis elegans

Alignment Length:257 Identity:53/258 (21%)
Similarity:94/258 (36%) Gaps:81/258 (31%)


  Fly   223 LNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEH 287
            :||:.....| .:|:.||..|:.         .:|.|::     |.||.|           ||.|
 Worm    58 VNIEIHVQDM-GSLNEISSDFEI---------DILFTQL-----WHDSAL-----------SFAH 96

  Fly   288 ---------------PDLRIWKPHMNVLNGALQSM-GQVLQSYELMVYANGSITLYAQNLQLASW 336
                           |  :||.|:..::|....:: ....::..:::|.||::.: ...|.:.|.
 Worm    97 LPACKRNITMETRLLP--KIWSPNTCMINSKRTTVHASPSENVMVILYENGTVWI-NHRLSVKSP 158

  Fly   337 CVDSARNWPSERVTCDI----------ELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSF 391
            |....|.:|.:..||.:          |:.|:..|  |.|.|:     |||            ..
 Worm   159 CNLDLRQFPFDTQTCILIFESYSHNSEEVELHWME--EAVTLM-----KPI------------QL 204

  Fly   392 TQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFV 453
            ....:|......:....|.|...::    .:.||.:|...||:...|:|   ..:.:|:|:|
 Worm   205 PDFDMVHYSTKKETLLYPNGYWDQL----QVTFTFKRRYGFYIIQAYVP---TYLTIIVSWV 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 46/232 (20%)
mod-1NP_741580.1 LIC 7..479 CDD:273305 53/258 (21%)
Neur_chan_LBD 34..239 CDD:280998 46/233 (20%)
Neur_chan_memb 247..476 CDD:280999 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.