DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and glc-3

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_504441.1 Gene:glc-3 WormBaseID:WBGene00001593 Length:484 Species:Caenorhabditis elegans

Alignment Length:282 Identity:54/283 (19%)
Similarity:87/283 (31%) Gaps:130/283 (46%)


  Fly   267 WRDSRL--------------------VWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVL 311
            |.|.||                    :|.|:.|...|...|.. .|.||  |||           
 Worm    90 WVDGRLAYGFPGDSTPDFLILTAGQQIWMPDSFFQNEKQAHKH-DIDKP--NVL----------- 140

  Fly   312 QSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKP 376
                :.::.:|.| ||:..:.:...|....:.:|.:..||.|:|                     
 Worm   141 ----IRIHRDGRI-LYSVRISMVLSCPMHLQYYPMDVQTCLIDL--------------------- 179

  Fly   377 IAPNEHVNTPSGWSFTQMSVVLVENDSQRRYN-------PKGMMQKM------------------ 416
                      :.:::|       |||.:.|:.       .||:...:                  
 Worm   180 ----------ASYAYT-------ENDIEYRWKKTDPVQLKKGLHSSLPSFELNNVDTTLCTSKTN 227

  Fly   417 TGDVAIEFT---LQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMT 478
            ||..:...|   |:|..|:|:...|:|               ||        .|:|.:|...::.
 Worm   228 TGTYSCLRTVLELRRQFSYYLLQLYIP---------------ST--------MLVIVSWVSFWLD 269

  Fly   479 RYASPHYVPPMMTAYKVIMMTT 500
            |.|.|..|...:|.  ::.|||
 Worm   270 RGAVPARVTLGVTT--LLTMTT 289

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 37/210 (18%)
glc-3NP_504441.1 Neur_chan_LBD 28..243 CDD:280998 37/210 (18%)
LIC 29..475 CDD:273305 54/283 (19%)
Neur_chan_memb 251..472 CDD:280999 15/65 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.