DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-26

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_503167.1 Gene:lgc-26 WormBaseID:WBGene00021981 Length:486 Species:Caenorhabditis elegans

Alignment Length:406 Identity:86/407 (21%)
Similarity:152/407 (37%) Gaps:129/407 (32%)


  Fly   201 GYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMM 265
            ||.|::.|:..|.|.|: :..:|||        |::..:..|        |||:.:   ..|:|.
 Worm    37 GYNSKVRPVKVESTVTQ-VAVYLNI--------AHVEKVDEH--------EQTALV---HGHLMA 81

  Fly   266 HWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGAL-QSMGQVLQSYELMVYANGSITLYAQ 329
            .|.|..|.|: ....::.:......::|:|.:.:.|.|. .|....|.....:||..|.:     
 Worm    82 SWTDEYLKWE-RKATNISTLSIASSKLWQPALQLYNSARGNSWSLYLTGLPAIVYNTGKV----- 140

  Fly   330 NLQLASW----------CVDSARNWPSERVTCDIEL-----GLNGQ-----------EGQENVAL 368
                  |          |.....|||.::.:|.|.:     || ||           .|:..:.|
 Worm   141 ------WSRGTFSFFVTCQFDFTNWPYDQQSCPIVITDWVYGL-GQVNLSDPATAAGYGKPTIRL 198

  Fly   369 IYDDQRKPI--APNEHVNTPSGWSFTQMSVVLVENDSQRR---YNPKGMMQ-KMTGD-----VAI 422
            .||    ||  ....||   .||...         ||.::   :.|||.:. :..|:     ..:
 Worm   199 SYD----PIDETNKRHV---GGWEVI---------DSWKKHCYWGPKGCLDAEPDGNPDWYWSLL 247

  Fly   423 EF--TLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIAL---LIAAWGLMYMTRYAS 482
            ||  ||:|:..::.....:|:::..:.::|.|.:.:. ..::.||.|   |.|.:|...::|   
 Worm   248 EFGITLKRHLPYFSLTIVMPMVSTSLMILLGFWIENF-DFNVFLITLNIALQATYGSNILSR--- 308

  Fly   483 PHYVPP-------MMTAYKVIMMTTTYCYILHICIIWLDLYPPRSKAPGWLVRVINSNVLRCILG 540
               :||       ::..|.:.::.:.:..:|                      ::.||.||..|.
 Worm   309 ---MPPGSGRTPKIVHLYSIGLLISAFQVVL----------------------IVMSNFLRVRLP 348

  Fly   541 LRFSDSTDYCDIQENP 556
            ..:.....| ||.|.|
 Worm   349 SHYEFDFGY-DITEIP 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 58/257 (23%)
lgc-26NP_503167.1 Neur_chan_LBD 27..256 CDD:280998 62/268 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.