DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lev-1

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001255705.1 Gene:lev-1 WormBaseID:WBGene00002974 Length:507 Species:Caenorhabditis elegans

Alignment Length:424 Identity:74/425 (17%)
Similarity:146/425 (34%) Gaps:145/425 (34%)


  Fly   199 FDGYGSEIAPIVKEETKTE---------KLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTS 254
            |.||.|.:.|:   ..::|         :|:..:|:                         ::..
 Worm    46 FRGYNSLVQPV---RNRSELPMIVKIGMQLVLLINV-------------------------DEKE 82

  Fly   255 SLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVY 319
            .::.|.:.:.|.|.|.:|.|.|.|:.::........::|.|.:.:.|.| ....:|.....:::.
 Worm    83 QVMHTNVWLTMKWDDFQLKWDPRDYANITQIRVAPEKVWLPDIVLFNNA-DGNYEVSFMCNVLIL 146

  Fly   320 ANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIY--DDQRKPIAPNEH 382
            :.|:: |:.......|.|:.....:|.:...|.:..|          :..|  |:.:.....::.
 Worm   147 STGTV-LWVPPAIYKSSCIIDVEFFPFDDQLCSLTFG----------SWTYNRDEIKLDFLTSDR 200

  Fly   383 V-----NTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFY--------- 433
            |     :|.|.|.......||..:.|:               :..:..::|...||         
 Worm   201 VDFSEYSTSSIWDMMDGPAVLTSDRSR---------------IEFQIRIRRKTLFYTVVLILPTV 250

  Fly   434 ------MTVFYLP-------------LIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTR 479
                  :||||||             |::..:||:|...:.....||:.|:|            :
 Worm   251 LMAFLNVTVFYLPTASGEKMGLTMNVLLSIVVFLLLVSKILPPTSSSIPLVA------------K 303

  Fly   480 YASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLY---PPRSKAPGWLVRVINSNVLRCILGL 541
            |....:|..::|    ||:||..|          ::|   |...:.|.| ||.:..::|..::.:
 Worm   304 YLLLTFVLNIIT----IMVTTIIC----------NIYFRSPITHRLPPW-VRKVFLDILPLLMCM 353

  Fly   542 RFSDSTDYC------------DIQENPW----HH 559
            :.....:..            .::|||.    ||
 Worm   354 QRPHRKNVIQRSHRRLLETGPSVEENPMRSGEHH 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 33/233 (14%)
lev-1NP_001255705.1 LIC 15..474 CDD:273305 74/425 (17%)
Neur_chan_LBD 38..238 CDD:280998 38/247 (15%)
Neur_chan_memb 245..470 CDD:280999 34/171 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.