DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and acc-1

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001293865.1 Gene:acc-1 WormBaseID:WBGene00010275 Length:470 Species:Caenorhabditis elegans

Alignment Length:368 Identity:68/369 (18%)
Similarity:131/369 (36%) Gaps:125/369 (34%)


  Fly   267 WRDSRLVWKPEDFGSLE---SFEHPDL-RIWKPHMNVLNGALQSMGQ-VLQSYELMVYANGSI-T 325
            |.|..||:  ||....:   ||:...| |:|.|:...:|....::.: ..::..|||::||:: |
 Worm    90 WEDPALVY--EDMNPCKRNISFDDKVLQRLWLPNTCFINSKSAAIHESPFKNVFLMVFSNGTLWT 152

  Fly   326 LYAQNLQLASWCVDSARNWPSERVTCDIEL-GLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGW 389
            .|  .::|...|....:.:|.::..|.:.. ..|...|:..:..   :|..|:...:.:..|. :
 Worm   153 NY--RMKLTGPCDMKLKRFPFDKQKCYLTFESFNYNTGEVRMQW---NQPYPVILLKRIELPD-F 211

  Fly   390 SFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVL 454
            .....||:.||     :..|.|...::|    :.|..:|...:|:...|:|              
 Worm   212 KLVNFSVIAVE-----QMYPAGWWDELT----VAFVFERRYGWYVLQGYIP-------------- 253

  Fly   455 RSTRRSSLILIALLIAAWGLMYMTRYASPHYVP--PMMTAYKVIMMTTTYCYILH---------- 507
                     .:..::.:|    ::.|..|..:|  .|:....::.||..:..|:.          
 Worm   254 ---------TMVTIVISW----ISFYLGPRAIPARTMLGVNSLLAMTFQFGNIIRNLPRVSYVKA 305

  Fly   508 --------ICIIWLDL--------------YPPRSK-------------------APG------W 525
                    :..|:|.|              .||:.|                   :|.      |
 Worm   306 IDVWMLSGMLFIFLSLLELAVVGFMSRNEGLPPKVKKRKRQEDDDEGFSWKSMQTSPHLELRQFW 370

  Fly   526 LVRVINSNVLRCILGLRFSDST-----DYCDIQ-ENPWHHMAK 562
            :.:.:||        || :||.     ||..:: |.|:.::.|
 Worm   371 VDKRVNS--------LR-NDSAVPPVEDYAPMELEQPYQNITK 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 38/169 (22%)
acc-1NP_001293865.1 Neur_chan_LBD 38..243 CDD:280998 38/170 (22%)
LIC 39..453 CDD:273305 68/369 (18%)
Neur_chan_memb 251..450 CDD:280999 29/191 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.