DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-10

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001293778.1 Gene:lgc-10 WormBaseID:WBGene00022247 Length:450 Species:Caenorhabditis elegans

Alignment Length:388 Identity:75/389 (19%)
Similarity:136/389 (35%) Gaps:81/389 (21%)


  Fly   199 FDGYGSEIAPIVKEETKTEK--LLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRM 261
            |.||...:.|.|:.......  :|..|....||..:.|.:.|   |.|                 
 Worm    35 FVGYDRRVLPFVQGPVLVNMTIVLGILIELKENQQLAAYVIS---HTQ----------------- 79

  Fly   262 HMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQS-YELMVYANGSIT 325
                .|.|.||.|.|..:........|...:|.|.:.|.| :|:|...:.:: .::.:|.||.|.
 Worm    80 ----RWYDGRLSWDPSKYRGQREVIVPQTMVWIPKLFVYN-SLESKDMLTENRADVRLYHNGRIK 139

  Fly   326 L----YAQNLQLASWCVDSARNWPSERVTCDIELG---LNGQEGQENVALIYDDQRKPIAPNEHV 383
            :    |.|.:     |.....::|.:...|.:.|.   ||..|      ::.:..:.|  .:.:.
 Worm   140 INIPQYVQAI-----CRIQTESFPFDCQFCAVALASPLLNVNE------MVVNATQPP--RDSYF 191

  Fly   384 NTPSGWSFTQMSV--VLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQM 446
            :..:.|....::|  :..|.:.:.|.           ::...|.|||...:|:||...|......
 Worm   192 SGNAEWYLFNVTVRHMTFEEEGESRV-----------EIHYVFHLQRRPIYYITVIVAPTFLISA 245

  Fly   447 FLILSFVLRSTR---RSSLILIAL--LIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYCYIL 506
            ..||......:.   |:..:.:.|  |:|...|:.:...|.|......:..|.::.:.......:
 Worm   246 LSILGIFSPGSNDGPRNEKVSLGLGSLLAMTVLLGIVAGAMPKSNDIPLLGYYILAVIVLCAVAV 310

  Fly   507 HICIIWLDL---YPPRSKAPGWLV---------RVINSNVLRCILGLRFSDSTD---YCDIQE 554
            .|.:::|.:   |..:.:.|...:         |...|.|.|.:...||:...|   |..:.|
 Worm   311 AISMMFLAVTRHYIQKEQMPSKRILRFLFLHEYRKRRSTVFRGVHNYRFNQECDDLMYSKVPE 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 43/229 (19%)
lgc-10NP_001293778.1 Neur_chan_LBD 28..229 CDD:280998 48/243 (20%)
Neur_chan_memb 236..>342 CDD:280999 15/106 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.