DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and acc-4

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_499789.1 Gene:acc-4 WormBaseID:WBGene00012099 Length:408 Species:Caenorhabditis elegans

Alignment Length:373 Identity:73/374 (20%)
Similarity:136/374 (36%) Gaps:85/374 (23%)


  Fly   238 SISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPD-----LRIWKPHM 297
            ||....|..|...|.||. .:..:::...|.|..|.:  ......:|....|     .:||.||.
 Worm    77 SIEIWVQEVSKIIEITSE-FELDIYVTERWTDPSLAY--SHLNPCKSNMSVDGATILNKIWNPHA 138

  Fly   298 NVLNGALQSMGQ-VLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQE 361
            ..:|..|.::.: ..::..|.:|:|||| .:...::|...|..:.|.:|.::..|          
 Worm   139 CFVNSKLANIHESPFKNIFLQIYSNGSI-WHNYRIKLTGPCSSTLRTFPIDQQRC---------- 192

  Fly   362 GQENVALIYD------DQRK--------PIAPNEHVNTPSGWSFTQMSVVLVE--NDSQRRYNPK 410
                 .|.|:      ||.|        ||       |....:.|....|||:  :.|:.|..|.
 Worm   193 -----MLFYESFTHNTDQVKMEWITTVPPI-------TILKGNITLPDYVLVDFSSSSELRLYPP 245

  Fly   411 GMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLM 475
            |:..::..    .||.||...||:...|:|.........:||.|.:.:..|...:.:.    .|:
 Worm   246 GIFNELIA----TFTFQRLYGFYILQVYVPAYISVFISWVSFTLGAEQIPSRTTVGVN----SLL 302

  Fly   476 YMT-RYASPHYVPPMMTAYKVI------MMTTTYCYILHICIIWLDLYPPRSKAPGWLVRVINSN 533
            .:| ::.:.....|..:..|.|      .|...:..::.:.::            |:|.|.....
 Worm   303 ALTFQFGAVVNNLPKTSDVKAIDVWILSSMAFIFASLIELAVV------------GYLSRDGQHG 355

  Fly   534 VLRCILGLRFSDSTDYCDIQENPWHHMAKILNNLSSILVIITFAIVDI 581
            .::|.......:..|:..::          ::.:|||:..::|...:|
 Worm   356 SIKCRCSWLCMNCKDWTALK----------IDQMSSIVFPVSFLAFNI 393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 49/213 (23%)
acc-4NP_499789.1 Neur_chan_LBD 53..>366 CDD:332142 67/335 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.