DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and cup-4

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_498710.2 Gene:cup-4 WormBaseID:WBGene00000845 Length:433 Species:Caenorhabditis elegans

Alignment Length:414 Identity:76/415 (18%)
Similarity:144/415 (35%) Gaps:86/415 (21%)


  Fly   199 FDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHM 263
            |.||..:..|:                  :|||.|   :.:..|:....::..|....:....|:
 Worm    56 FRGYNPKNRPM------------------KNASFP---TIVDVHWHIIHVSINQREQTMTVHGHI 99

  Fly   264 MMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGA----------------LQSMGQVLQ 312
            .|.|.|..|||.|:||.:::.......::|:|.:.|.|.|                :|.||:...
 Worm   100 YMRWFDEFLVWDPKDFNNIQYARVKKWQVWQPKIKVSNSASGLGSAFDFSTSAHVIIQMMGKDRA 164

  Fly   313 SYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPI 377
            ..|:  |...||.:         .|.....::|.:...|.|.|..........:..:|     .|
 Worm   165 KVEM--YPTFSIKV---------GCAFDFTDYPYDLNKCAINLFSTSTMADVQLQNLY-----AI 213

  Fly   378 APNEHVNTPSGWSFTQMSVVL----VEN-DSQRRYNPKGMMQK---MTG--------DVAIEFTL 426
            .|    ....||...:|..::    ::| .|...|...|.:..   :||        .:|:..:.
 Worm   214 PP----TLSFGWEEQKMKRIISDFKIQNVSSSALYYTNGNITSSAPITGFDLGSTWSMLAVTVSF 274

  Fly   427 QRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYA-----SPHYV 486
            .|:...:......|.|.....:.::|.:.|.  ||..|:.:|.....|:::....     |...:
 Worm   275 VRHSPLFEAAVVTPCIVVASLISMTFFIDSL--SSTFLLMMLHFYVQLIFLHDLVEKLPLSVSEI 337

  Fly   487 PPMMTAYKVIMMTTTYCYILHICIIWLDLYPPRSKAPGWLVRVINSNVLRCILGLRFSDSTDYCD 551
            |..:....::|.|.....:||..::....|  :...|..|.::.   |:...:...|.:......
 Worm   338 PFCIKLIGILMYTNGLTLVLHSSLLCGSYY--KCPVPQQLNKIF---VIEEYIPNTFKEKVQIKK 397

  Fly   552 IQEN-PWHHMAKILNNLSSILVII 574
            .:.| .|..:.|::..:...::||
 Worm   398 EESNKSWRDLMKLIRPIIGFVLII 421

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 47/249 (19%)
cup-4NP_498710.2 Neur_chan_LBD 48..>222 CDD:280998 42/207 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.