DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-46

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_497338.2 Gene:lgc-46 WormBaseID:WBGene00022106 Length:508 Species:Caenorhabditis elegans

Alignment Length:388 Identity:75/389 (19%)
Similarity:133/389 (34%) Gaps:98/389 (25%)


  Fly   195 YDCGFDGYGSEIAPIV---KEETKTEK----------LLSHLN----------IQAEN-ASMPAN 235
            ||...|.:|. :.||:   |.|..|:.          ::|:.|          ::.|. ......
 Worm    37 YDWEVDEHGG-LKPIINPAKVERATKNCANDSFILGTIMSNYNRHKIPGGQVDVEVEVWVQEITT 100

  Fly   236 LSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHP---DL------- 290
            :|.|:..||.....||.              |.|..|.:         :|.:|   :|       
 Worm   101 ISDITSDFQLDIYIYET--------------WYDPALNY---------AFMNPCKYNLSLNSVLL 142

  Fly   291 -RIWKPHMNVLNGALQSMGQ-VLQSYELMVYANGSI-TLYAQNLQLASWCVDSARNWPSERVTCD 352
             ::|.|:...:|.....:.: ...:..||:||||:: |.|  .|:|...|:.....:|.:.|||.
 Worm   143 EKLWTPNSCFINSKTADIHKSPFPNIFLMIYANGTVWTNY--RLKLQGPCIMDLTKFPFDNVTCS 205

  Fly   353 IELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMT 417
            :..        |:.....|:.:...:.|...............:|.:.........|.|...::|
 Worm   206 LTF--------ESFNYNTDEVKMDWSVNGVQKMRDKMELADYELVDIHKIRTTEEYPAGYWHELT 262

  Fly   418 GDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMT-RYA 481
                :.|..:|...:|:...|||.........:||.|    .|..|....::....|:.|| ::.
 Worm   263 ----MSFEFKRRAGWYILQAYLPTYLTICISWISFAL----GSKAIPARTMLGVNSLLAMTFQFG 319

  Fly   482 SPHYVPPMMTAYKVI------MMTTTYCYILHICIIWLDLYPPRSKAPGWLVRVINSNVLRCI 538
            :.....|.::..|.|      .||..:|.:|.:.  |:          |:|.|.......:|:
 Worm   320 NIIRNLPRVSYVKAIDVWMLSCMTFVFCSLLELA--WV----------GYLSREEEPTSAKCL 370

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 44/251 (18%)
lgc-46NP_497338.2 Neur_chan_LBD 73..504 CDD:332142 66/352 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.