DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-20

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_496423.1 Gene:lgc-20 WormBaseID:WBGene00007191 Length:454 Species:Caenorhabditis elegans

Alignment Length:393 Identity:76/394 (19%)
Similarity:141/394 (36%) Gaps:108/394 (27%)


  Fly   265 MHWRDSRLVWKPEDFGSLESFEH----PDLRIWKPHMNVLNGALQSMGQVLQSY-ELMVYANGSI 324
            ::|:|.|:.|..:  |..|::||    ....||.||  |::..|.|.|....|. ::.:|.:|:|
 Worm    98 LNWKDERMKWDKK--GEFENYEHLYIFNSSAIWTPH--VIDHTLCSEGGCSYSVDDVDIYDDGTI 158

  Fly   325 TLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGW 389
            ....|...|||..|| .|.:|.|..:|.| .....:...|...|:.:.:.|     |.:|.|   
 Worm   159 YARIQFKYLASCTVD-YRKFPEEDDSCCI-FFTAFEPNVEQTTLVLEGKEK-----EKMNRP--- 213

  Fly   390 SFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVL 454
                   |..:...::......::|:.:..|.:|.|:..:.          |...:...::...:
 Worm   214 -------VYAQKIYEKEKQLSDIVQEHSPWVVVEKTMSTSN----------LGGLKSLQVMQVCV 261

  Fly   455 RSTRRSSLILIALLIAAWGLMYMTRYASPHY---------------------------------- 485
            |:.::.|.:.:|||.......|: ..|||.:                                  
 Worm   262 RAEKQMSTVRVALLFPVTLATYV-MLASPLFGDLRTQIYVKLFSLHIQTLCFLYLCTITPLNGFL 325

  Fly   486 -VPPMMTAYKVIMMTTTYCYILHICIIWLDL------YPPRSKAPGWLVRVINSNVLRCILGLRF 543
             |.|.:..:..::.|.::..|| :.::.:.|      .||..:.  :|...:.:.|:.||...| 
 Worm   326 GVRPRIYIFYELIFTISFMSIL-VTLVVMALSRVKRNVPPSHRL--FLSAKLINRVVCCIEPER- 386

  Fly   544 SDSTDYCDIQENP--------------------------WHHMAKILNNLSSILVIITFAIVDIT 582
            ||:......::.|                          |.|:...:||:.|.|:...|..:...
 Worm   387 SDAYHRYVEEDTPESRTTSEVSQQQSVIRPGAELDYTQDWRHIYLAMNNMFSALMFSVFLFMTFL 451

  Fly   583 SGF 585
            ..|
 Worm   452 EFF 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 42/169 (25%)
lgc-20NP_496423.1 Neur_chan_LBD <88..>188 CDD:280998 31/96 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.