DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-27

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_740977.1 Gene:lgc-27 WormBaseID:WBGene00022283 Length:428 Species:Caenorhabditis elegans

Alignment Length:369 Identity:78/370 (21%)
Similarity:145/370 (39%) Gaps:93/370 (25%)


  Fly   263 MMMHWRDSRLVWKPEDFGS----LESFEHPDLRIWKPHMNVLNGALQSMGQ---VLQSYELMVYA 320
            :.:.|:|.||.|.||::.:    |:|..    |:|.|.:|  :..||:..|   .:..:::....
 Worm   107 LKLSWKDRRLRWNPEEWKTEVLRLKSMG----RLWSPDIN--SDKLQTGSQSTDFVNYHDIQSNY 165

  Fly   321 NGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHV-- 383
            ||::|...: .::.:.|......:|::|..|...|..|          :|....:.|..:|..  
 Worm   166 NGNVTARLE-FRMKAQCQIDYTEYPNDRKHCCFNLQSN----------LYKRYVRFIMEHEGAHE 219

  Fly   384 -----NTPSGW----SFTQMSVVLVEND--SQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVF 437
                 ||.:.|    .:|.:|.:..|||  ::|.....|:::| :..:|:|.|            
 Worm   220 MLNTKNTKTNWHIDPMYTWISKMNQENDNRAERLEVCVGVVRK-SSTLAVELT------------ 271

  Fly   438 YLPLIACQMFLILS-FVLRSTRRSSLILIALLIAAWGLMYMTRYASPHY-----VPPMMTAYKVI 496
             ||::...:.|:|: |..:..::..:.:.|||:......::.. .:|..     :|.:...|...
 Worm   272 -LPVLISALILLLAPFFGKFNQQIYVKMFALLLQFLSFQFLAE-KTPQLGFGDNIPKIYVFYAFT 334

  Fly   497 MMTTTYCYILHICIIWLD----LYPPRSKAPGWLVRVINSNVLRCILGLRFSDSTDYCDIQENP- 556
            :..|....|..:.|..:.    ..||..:.. .|..::|:|:  |            |..:|.| 
 Worm   335 IGMTVLSLIATVMISAMSRVKRKVPPAHRYT-LLASLLNANL--C------------CGSEEEPT 384

  Fly   557 ---------------WHHMAKILNNLSSILVIITFAIVDITSGF 585
                           |..:...||||||||:|..:.|..|...|
 Worm   385 TDGTSSKMSQDATSDWLQVHSALNNLSSILLIFIYIIGAIVIAF 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 42/186 (23%)
lgc-27NP_740977.1 Neur_chan_LBD 94..>204 CDD:280998 25/114 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.