DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and avr-14

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001020963.1 Gene:avr-14 WormBaseID:WBGene00000232 Length:430 Species:Caenorhabditis elegans

Alignment Length:293 Identity:59/294 (20%)
Similarity:107/294 (36%) Gaps:93/294 (32%)


  Fly   210 VKEETKTEKLLS----HLNIQAENASMPAN----LSSISFHFQTRSLAYEQTSSLLQTRMHMMMH 266
            :||:...:::|.    .:..:..||:.|..    |.:::.:.::.| ..:..:.....:......
 Worm    25 LKEQEIIQRILKDYDWRVRPRGMNATWPDTGGPVLVTVNIYLRSIS-KIDDVNMEYSAQFTFREE 88

  Fly   267 WRDSRLVW-KPEDFGSLE--------SFEHPD--LRIWKP------------HM----NVLNGAL 304
            |.|.||.: :.|:.|..|        :.|:.|  .:||.|            |:    |||    
 Worm    89 WTDQRLAYERYEESGDTEVPPFVVLATSENADQSQQIWMPDTFFQNEKEARRHLIDKPNVL---- 149

  Fly   305 QSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALI 369
                       :.::.||.| ||:..|.|...|..|...:|.:|..|.|:|.......|:   :.
 Worm   150 -----------IRIHKNGQI-LYSVRLSLVLSCPMSLEFYPLDRQNCLIDLASYAYTTQD---IK 199

  Fly   370 YD-DQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFT-------- 425
            |: .::|||.                     :.|..|:..|...:|.:..|.....|        
 Worm   200 YEWKEKKPIQ---------------------QKDGLRQSLPSFELQDVVTDYCTSLTNTGEYSCA 243

  Fly   426 -----LQRNRSFYMTVFYLPLIACQMFLILSFV 453
                 |:|..|:|:...|:|   |.|.:::|:|
 Worm   244 RVVLRLRREYSYYLIQLYIP---CIMLVVVSWV 273

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 50/266 (19%)
avr-14NP_001020963.1 LIC 20..424 CDD:273305 59/294 (20%)
Neur_chan_LBD 27..253 CDD:280998 50/267 (19%)
Neur_chan_memb 260..>355 CDD:280999 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.