DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and unc-63

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_491533.2 Gene:unc-63 WormBaseID:WBGene00006797 Length:502 Species:Caenorhabditis elegans

Alignment Length:371 Identity:75/372 (20%)
Similarity:144/372 (39%) Gaps:47/372 (13%)


  Fly   217 EKLLSHLNIQAENASMPANLSSISFHFQ-TRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFG 280
            |.|::..|......|.......::|..: ::.|...:.:.::.|.:.:...|.|.:|.|.|.::|
 Worm    32 EDLIADYNKLVRPVSENGETLVVTFKLKLSQLLDVHEKNQIMTTNVWLQHSWMDYKLRWDPVEYG 96

  Fly   281 SLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWP 345
            .:|....|...||.|.:.:.|.|..:....:.:...:.| ||::. :|......|.|......:|
 Worm    97 GVEVLYVPSDTIWLPDVVLYNNADGNYQVTIMTKAKLTY-NGTVE-WAPPAIYKSMCQIDVEFFP 159

  Fly   346 SERVTCDIELGLNGQEGQENVALIYDDQ--RKPIAPN-EHVNTPSGWSFTQMSVVLVE------- 400
            .:|..|:::.|.....|.| |.|.:.|:  .|.|..: |.|:.|     |:..|.:|:       
 Worm   160 FDRQQCEMKFGSWTYGGLE-VDLQHRDKHLEKEIEEDVEGVDGP-----TKEIVWVVDRGIDLSD 218

  Fly   401 ----------NDSQRRYNPK-GMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVL 454
                      |...:|::.: ...:....|:..|..|:|...||......|.:.......|.|.|
 Worm   219 YYPSVEWDILNVPGKRHSKRYPCCESPFIDITYEIHLRRKTLFYTVNLIFPSVGISFLTALVFYL 283

  Fly   455 RS---TRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLY 516
            .|   .:.|..|.|.:.:..:.|:.:....|...|.|::..|.:..|......:: :.::.|:::
 Worm   284 PSDGGEKISLCISILISLTVFFLLLVEIIPSTSLVIPLIGKYLLFTMVLVTLSVV-VTVVTLNVH 347

  Fly   517 ---PPRSKAPGWLVRVINSNVLRCILGLRFSDSTDYCDIQENPWHH 559
               |.....|.|:.|:....:.:.:|..|          .:.|.||
 Worm   348 YRSPTTHTMPKWMKRLFVDFLPKYLLMTR----------PQPPGHH 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 49/234 (21%)
unc-63NP_491533.2 LIC 6..487 CDD:273305 75/372 (20%)
Neur_chan_LBD 29..259 CDD:280998 49/235 (21%)
Neur_chan_memb 266..487 CDD:280999 24/130 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.