DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and unc-38

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_491472.1 Gene:unc-38 WormBaseID:WBGene00006774 Length:511 Species:Caenorhabditis elegans

Alignment Length:467 Identity:79/468 (17%)
Similarity:149/468 (32%) Gaps:131/468 (28%)


  Fly   176 LVINYLSFSSF--GSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSS 238
            |::..:||...  |:..|:..||.....|.....|    .|...|.|:        ..:...||.
 Worm    10 LLLFCISFIKLTEGNEDAKRLYDDLMVNYNRHRRP----STSPNKPLT--------IKLKLRLSQ 62

  Fly   239 ISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGA 303
            |        :...:...::...:.:...|.|.:|.|.|.::|.:.....|...||.|.:.:.|.|
 Worm    63 I--------IDVHEIDQIMTCSVWLKQTWIDRKLSWDPVNYGGVNVLYVPYEMIWVPDIVLYNNA 119

  Fly   304 LQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVAL 368
             .|...:..|.:..::..|.:| :.......|.|....|.:|.:...|.::.|            
 Worm   120 -DSNYNITISTKATLHYTGEVT-WEPPAIFKSMCQIDVRWFPFDEQQCHLKFG------------ 170

  Fly   369 IYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRY----NPKGMMQKMTG----------- 418
                               .|:|::..:.:..|:...||    :.||::..:|.           
 Worm   171 -------------------SWTFSENLLSVELNEPSLRYEEEIDEKGIIDNVTVAEDGIDLSDYY 216

  Fly   419 -----------------------------DVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVL 454
                                         ||.....|:|...||......|.:......||.|.|
 Worm   217 PSVEWDIMSRVAKRRAKNYPSCCPQSAYIDVTYYLQLRRKPLFYTVNLVFPCVGISFLTILVFYL 281

  Fly   455 RSTRRSSLILIALLIAAWGLMYMTRYASPHYVP------PMMTAYKVIMMTTTYCYILHICIIWL 513
            .|.....:.|...::.|..:.::   .....:|      |::..|.:..|......:: :.:|.|
 Worm   282 PSDSGEKVTLCISILVALTIFFL---LLTEIIPATSITLPLIGKYLLFTMVMVTLSVV-VTVISL 342

  Fly   514 DLY---PPRSKAPGWLVRVINSNVLRCILGLRF-----SDSTDYCDIQENP----------WHHM 560
            :|:   |.....|.|:.:|.    |:.:..|.|     .|..:..|.::.|          .|.:
 Worm   343 NLHFRTPTTHLMPNWVKKVF----LKWLPKLLFMRRPIDDYEEKFDDKKKPKDGKIALSVHAHRV 403

  Fly   561 AKILNNLSSILV 572
            :.:.||:.:..:
 Worm   404 SNVGNNIRNATI 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 4/17 (24%)
Neur_chan_LBD 212..429 CDD:280998 40/261 (15%)
unc-38NP_491472.1 Neur_chan_LBD 27..257 CDD:280998 45/283 (16%)
LIC 29..483 CDD:273305 74/449 (16%)
Neur_chan_memb 264..481 CDD:280999 28/161 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.