DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and glc-2

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_491470.1 Gene:glc-2 WormBaseID:WBGene00001592 Length:434 Species:Caenorhabditis elegans

Alignment Length:356 Identity:66/357 (18%)
Similarity:117/357 (33%) Gaps:141/357 (39%)


  Fly   223 LNIQAENASM-----PANLSSISFHFQTRSLAYEQTSSLLQTRMHMMM----------------- 265
            ||...:|..|     |||.|               |...:..|:::|:                 
 Worm    33 LNALLKNYDMRVRPPPANSS---------------TEGAVNVRVNIMIRMLSKIDVVNMEYSIQL 82

  Fly   266 ----HWRDSRLVWKPEDFGSLESF---EHPDLRIWKP----------HMNVLNGALQSMGQVLQS 313
                .|.|.||.::...|.:..:|   .|....:|.|          |.::::         :::
 Worm    83 TFREQWIDPRLAYENLGFYNPPAFLTVPHVKKSLWIPDTFFPTEKAAHRHLID---------MEN 138

  Fly   314 YELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDD----QR 374
            ..|.:|.:|.| ||:..:.|.|.|....:.:|.:..:|:.:| ::......::...:|.    |.
 Worm   139 MFLRIYPDGKI-LYSSRISLTSSCPMRLQLYPLDYQSCNFDL-VSYAHTMNDIMYEWDPSTPVQL 201

  Fly   375 KP----IAPN-------------EHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAI 422
            ||    ..||             .|.||.|                             .|.:.:
 Worm   202 KPGVGSDLPNFILKNYTTNADCTSHTNTGS-----------------------------YGCLRM 237

  Fly   423 EFTLQRNRSFYMTVFYLPLIACQMFLILSFV-----LRSTRRSSLILIALLIAAWGLMYMTRYAS 482
            :...:|..|:|:...|.|   ..|.:|:|:|     |.||...    :||.:..  |:.||    
 Worm   238 QLLFKRQFSYYLVQLYAP---TTMIVIVSWVSFWIDLHSTAGR----VALGVTT--LLTMT---- 289

  Fly   483 PHYVPPMMTAYKVIMMTTTYCYILHICIIWL 513
                 .|.:|....:...:|..::.   :||
 Worm   290 -----TMQSAINAKLPPVSYVKVVD---VWL 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 45/266 (17%)
glc-2NP_491470.1 LIC 29..419 CDD:273305 66/357 (18%)
Neur_chan_LBD 29..244 CDD:280998 45/266 (17%)
Neur_chan_memb 252..417 CDD:280999 19/83 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.