DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrna2

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_596911.1 Gene:Chrna2 RGDID:621533 Length:511 Species:Rattus norvegicus

Alignment Length:327 Identity:67/328 (20%)
Similarity:129/328 (39%) Gaps:32/328 (10%)


  Fly   217 EKLLSHL----NIQAENASMPANLSSISFHFQTRSLA-YEQTSSLLQTRMHMMMHWRDSRLVWKP 276
            ::|..||    |..|......:::..:.|......|. .::.:.::.|.:.:...|.|.:|.|.|
  Rat    37 DRLFKHLFGGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDP 101

  Fly   277 EDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSA 341
            .:||::.|...|...||.|.:.:.|.| .....|....:..::..|::......:..:|..:| .
  Rat   102 AEFGNVTSLRVPSEMIWIPDIVLYNNA-DGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSID-V 164

  Fly   342 RNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEH-VNTPSGWSFTQMSVVLVENDSQR 405
            ..:|.::..|.::.|          :..||..:..:...|. |:....|...:.:::    ::..
  Rat   165 TFFPFDQQNCKMKFG----------SWTYDKAKIDLEQMERTVDLKDYWESGEWAII----NATG 215

  Fly   406 RYNPK--GMMQKMTGDVAIEFTLQRNRSFYMTVFYLP--LIACQMFLILSFVLRSTRRSSLILIA 466
            .||.|  ....::..||...|.::|...||.....:|  ||:|...|:.........:.:|.:..
  Rat   216 TYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISV 280

  Fly   467 LLIAAWGLMYMTR-YASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLY---PPRSKAPGWLV 527
            ||.....|:.:|. ..|...|.|::..|.:..|......|: |.:..|:::   |.....|.| |
  Rat   281 LLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIV-ITVFVLNVHHRSPSTHNMPNW-V 343

  Fly   528 RV 529
            ||
  Rat   344 RV 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 41/220 (19%)
Chrna2NP_596911.1 LIC 35..504 CDD:273305 67/328 (20%)
Neur_chan_LBD 36..242 CDD:280998 41/221 (19%)
Neur_chan_memb 249..502 CDD:280999 24/100 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.