| Sequence 1: | NP_651958.2 | Gene: | NtR / 43935 | FlyBaseID: | FBgn0029147 | Length: | 585 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_570126.2 | Gene: | HTR3C / 170572 | HGNCID: | 24003 | Length: | 447 | Species: | Homo sapiens | 
| Alignment Length: | 362 | Identity: | 69/362 - (19%) | 
|---|---|---|---|
| Similarity: | 129/362 - (35%) | Gaps: | 63/362 - (17%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   198 GFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMH 262 
  Fly   263 MMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLY 327 
  Fly   328 AQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFT 392 
  Fly   393 QMSVVLVENDSQ------RRYNPK-GMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLI- 449 
  Fly   450 ---LSFVL--RSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMM---------TT 500 
  Fly   501 TYCYILHICIIWLDLYPPRSKAPGWLVRVINSNVLRC 537 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| NtR | NP_651958.2 | Methyltransf_FA | 90..191 | CDD:289052 | |
| Neur_chan_LBD | 212..429 | CDD:280998 | 32/223 (14%) | ||
| HTR3C | NP_570126.2 | Neur_chan_LBD | 43..445 | CDD:332142 | 64/351 (18%) | 
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 380..405 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3645 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||