DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and CHRNG

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_005190.4 Gene:CHRNG HGNCID:1967 Length:517 Species:Homo sapiens

Alignment Length:348 Identity:68/349 (19%)
Similarity:138/349 (40%) Gaps:41/349 (12%)


  Fly   211 KEETKTEKLLSHLNIQAENASMPANLSSISFHFQ-TRSLAYEQTSSLLQTRMHMMMHWRDSRLVW 274
            :||.....|:.:.:.....|...:::.::|.... |..::..:....|.|.:.:.|.|.|.||.|
Human    25 QEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDYRLRW 89

  Fly   275 KPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVD 339
            .|.|:..|.....|...:|:|.: ||...:..:.:|.....::|..:|.| .:.......|.|..
Human    90 DPRDYEGLWVLRVPSTMVWRPDI-VLENNVDGVFEVALYCNVLVSPDGCI-YWLPPAIFRSACSI 152

  Fly   340 SARNWPSERVTC------------DIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFT 392
            |...:|.:...|            :|:|.|:.::|| .:..|:.|   |.|..|:    ..|:  
Human   153 SVTYFPFDWQNCSLIFQSQTYSTNEIDLQLSQEDGQ-TIEWIFID---PEAFTEN----GEWA-- 207

  Fly   393 QMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTL--QRNRSFYMTVFYLP--LIACQMFLILSFV 453
                 :....::...:|....|: .|...:.|.|  ||...||:.....|  ||:....||....
Human   208 -----IQHRPAKMLLDPAAPAQE-AGHQKVVFYLLIQRKPLFYVINIIAPCVLISSVAILIHFLP 266

  Fly   454 LRSTRRSSLILIALLIAAWGLMYMTRYASPH--YVPPMMTAYKVIMMTTTYCYILH-ICIIWLDL 515
            .::..:...:.|.:|:|....:::.....|.  ...|:::.|...::..|...::: :.::.:.|
Human   267 AKAGGQKCTVAINVLLAQTVFLFLVAKKVPETSQAVPLISKYLTFLLVVTILIVVNAVVVLNVSL 331

  Fly   516 YPPRSKAPGWLVRVINSNVLRCI 538
            ..|.:.:   :.|.:....||.:
Human   332 RSPHTHS---MARGVRKVFLRLL 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 49/232 (21%)
CHRNGNP_005190.4 LIC 23..495 CDD:273305 68/349 (19%)
Neur_chan_LBD 26..241 CDD:280998 49/233 (21%)
Neur_chan_memb 248..492 CDD:280999 17/108 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.