| Sequence 1: | NP_651958.2 | Gene: | NtR / 43935 | FlyBaseID: | FBgn0029147 | Length: | 585 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_446176.3 | Gene: | Glra3 / 114516 | RGDID: | 621229 | Length: | 480 | Species: | Rattus norvegicus |
| Alignment Length: | 338 | Identity: | 76/338 - (22%) |
|---|---|---|---|
| Similarity: | 139/338 - (41%) | Gaps: | 67/338 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 173 EAPLVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLN-----IQAENASM 232
Fly 233 PANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWK--PEDFGSLESFEHPDL--RIW 293
Fly 294 KPHMNVLNGALQSMGQVLQSYELM-VYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGL 357
Fly 358 NGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAI 422
Fly 423 EFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVP 487
Fly 488 PMMTAYKVIMMTT 500 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| NtR | NP_651958.2 | Methyltransf_FA | 90..191 | CDD:289052 | 4/17 (24%) |
| Neur_chan_LBD | 212..429 | CDD:280998 | 51/226 (23%) | ||
| Glra3 | NP_446176.3 | LIC | 28..467 | CDD:273305 | 76/338 (22%) |
| Neur_chan_LBD | 63..269 | CDD:280998 | 52/223 (23%) | ||
| Neur_chan_memb | 276..464 | CDD:280999 | 14/64 (22%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||