DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and Glra3

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_446176.3 Gene:Glra3 / 114516 RGDID:621229 Length:480 Species:Rattus norvegicus


Alignment Length:338 Identity:76/338 - (22%)
Similarity:139/338 - (41%) Gaps:67/338 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 EAPLVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLN-----IQAENASM 232
            ||.|:::.::...  :|:||           |..||:...:. .:||:...:     |:......
  Rat    34 EAALLLSLVATKE--TNSAR-----------SRSAPMSPSDF-LDKLMGRTSGYDARIRPNFKGP 84

  Fly   233 PANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWK--PEDFGSLESFEHPDL--RIW 293
            |.|::...|.....|:|  :|:...:..:.:...|.|.||.:.  |:|...|:    |.:  .||
  Rat    85 PVNVTCNIFINSFGSIA--ETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLD----PSMLDSIW 143

  Fly   294 KPHMNVLNGALQSMGQVLQSYELM-VYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGL 357
            ||.:...|....:..:|....:|: ::.||:: ||:..|.|...|....:|:|.:..||.::|..
  Rat   144 KPDLFFANEKGANFHEVTTDNKLLRIFKNGNV-LYSIRLTLTLSCPMDLKNFPMDVQTCIMQLES 207

  Fly   358 NGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAI 422
            .|....:   ||::.|.:  ||   |....|.:..|.   |::.:...||..|.........:.:
  Rat   208 FGYTMND---LIFEWQDE--AP---VQVAEGLTLPQF---LLKEEKDLRYCTKHYNTGKFTCIEV 261

  Fly   423 EFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVP 487
            .|.|:|...:|:...|:|                    ||:::   |.:|...::...|:|..|.
  Rat   262 RFHLERQMGYYLIQMYIP--------------------SLLIV---ILSWVSFWINMDAAPARVA 303

  Fly   488 PMMTAYKVIMMTT 500
            ..:|.  |:.|||
  Rat   304 LGITT--VLTMTT 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 4/17 (24%)
Neur_chan_LBD 212..429 CDD:280998 51/226 (23%)
Glra3NP_446176.3 LIC 28..467 CDD:273305 76/338 (22%)
Neur_chan_LBD 63..269 CDD:280998 52/223 (23%)
Neur_chan_memb 276..464 CDD:280999 14/64 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.