DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and CHRNE

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_000071.1 Gene:CHRNE HGNCID:1966 Length:493 Species:Homo sapiens

Alignment Length:373 Identity:72/374 (19%)
Similarity:145/374 (39%) Gaps:56/374 (15%)


  Fly   187 GSNTARWFYDCGFDGYGSEIAPIVK-EETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAY 250
            |.|.....|...|:.|.....|:.: |:|.|             .|:...|:::        ::.
Human    20 GKNEELRLYHHLFNNYDPGSRPVREPEDTVT-------------ISLKVTLTNL--------ISL 63

  Fly   251 EQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYE 315
            .:....|.|.:.:.:.|:|.||.:..:|||.:|:...|...:|.|.: ||...:.....|.....
Human    64 NEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEI-VLENNIDGQFGVAYDAN 127

  Fly   316 LMVYANGSIT-----LYAQNLQLASWCVDSARNWPSERVTCDI---ELGLNGQEGQENVALIYDD 372
            ::||..||:|     :|      .|.|......:|.:...|.:   ....|.:|.:...|:  |:
Human   128 VLVYEGGSVTWLPPAIY------RSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTFAV--DN 184

  Fly   373 QRKPIAP---NEHVNTPSG-WSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFY 433
            ..|.|..   :....|.:| |:......|:      ||::..........||.....::|...||
Human   185 DGKTINKIDIDTEAYTENGEWAIDFCPGVI------RRHHGGATDGPGETDVIYSLIIRRKPLFY 243

  Fly   434 MTVFYLPLIACQMFLILSFVL--RSTRRSSLILIALLIAAWGLMYMTRYASPH--YVPPMMTAYK 494
            :....:|.:.....::|::.|  ::..:...:.|.:|:|....:::.....|.  ...|::..:.
Human   244 VINIIVPCVLISGLVLLAYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKIPETSLSVPLLGRFL 308

  Fly   495 VIMMTTTYCYILHICIIWLDL--YPPRSKAPGWLVRVINSNVLRCILG 540
            :.:|......::: |:|.|::  ..|.:.|....:|.:...:|..:||
Human   309 IFVMVVATLIVMN-CVIVLNVSQRTPTTHAMSPRLRHVLLELLPRLLG 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 2/4 (50%)
Neur_chan_LBD 212..429 CDD:280998 46/229 (20%)
CHRNENP_000071.1 LIC 21..475 CDD:273305 71/373 (19%)
Neur_chan_LBD 24..240 CDD:280998 50/252 (20%)
Neur_chan_memb 247..474 CDD:280999 18/111 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.