DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrng

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_006529141.1 Gene:Chrng MGIID:87895 Length:541 Species:Mus musculus

Alignment Length:372 Identity:76/373 (20%)
Similarity:138/373 (37%) Gaps:68/373 (18%)


  Fly   204 SEIAPIV---KEETKTEKLLSHLNIQAENASMPANLSS----ISFHFQ-TRSLAYEQTSSLLQTR 260
            ||..|.|   :...:.|:||:.|....:....||...|    :|.... |..::..:....|.|.
Mouse    33 SEPPPSVAGAQSRNQEERLLADLMRNYDPHLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTN 97

  Fly   261 MHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSIT 325
            :.:.|.|.|.||.|.|:|:..|.....|...:|:|.: ||...:..:.:|.....::|..:|.| 
Mouse    98 VWIEMQWCDYRLRWDPKDYEGLWILRVPSTMVWRPDI-VLENNVDGVFEVALYCNVLVSPDGCI- 160

  Fly   326 LYAQNLQLASWCVDSARNWPSERVTC------------DIELGLNGQEGQENVALIYDDQRKPIA 378
            .:.......|.|..|...:|.:...|            :|.|.|:.::||. :..|:.|   |.|
Mouse   161 YWLPPAIFRSSCSISVTYFPFDWQNCSLVFQSQTYSTSEINLQLSQEDGQA-IEWIFID---PEA 221

  Fly   379 PNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMM------------QKMTGDVAIEFTLQRNRS 431
            ..|:    ..|:.              |:.|..|:            ||    |.....:||...
Mouse   222 FTEN----GEWAI--------------RHRPAKMLLDSVAPAEEAGHQK----VVFYLLIQRKPL 264

  Fly   432 FYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIA--LLIAAWGLMYMTRYASPH--YVPPMMTA 492
            ||:.....|.:......||.:.|.:........:|  :|:|....:::.....|.  ...|:::.
Mouse   265 FYVINIIAPCVLISSVAILIYFLPAKAGGQKCTVATNVLLAQTVFLFLVAKKVPETSQAVPLISK 329

  Fly   493 YKVIMMTTTYCYILH-ICIIWLDLYPPRSKAPGWLVRVINSNVLRCI 538
            |...:|..|...::: :.::.:.|..|.:.:   :.|.:....||.:
Mouse   330 YLTFLMVVTILIVVNSVVVLNVSLRSPHTHS---MARGVRKVFLRLL 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 53/246 (22%)
ChrngXP_006529141.1 LIC 45..519 CDD:273305 72/361 (20%)
Neur_chan_LBD 48..263 CDD:280998 53/243 (22%)
Neur_chan_memb 270..516 CDD:280999 17/108 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.