DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrne

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_006532069.1 Gene:Chrne MGIID:87894 Length:494 Species:Mus musculus

Alignment Length:379 Identity:79/380 (21%)
Similarity:146/380 (38%) Gaps:64/380 (17%)


  Fly   185 SFGSNTARWFYDCGFDGYGSEIAPIVK-EETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSL 248
            |.|.|.....|...||.|..|..|:.: |:|.|..|...|          .||.|::        
Mouse    18 SQGKNEELSLYHHLFDNYDPECRPVRRPEDTVTITLKVTL----------TNLISLN-------- 64

  Fly   249 AYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQS 313
               :....|.|.:.:.:.|.|.||.:..:||..:.....|...:|.|.: ||...:.....|...
Mouse    65 ---EKEETLTTSVWIGIDWHDYRLNYSKDDFAGVGILRVPSEHVWLPEI-VLENNIDGQFGVAYD 125

  Fly   314 YELMVYANGSIT-----LYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIY--D 371
            ..::||..|.::     :|      .|.|......:|.:...|.: :..:.....|.|..|:  |
Mouse   126 SNVLVYEGGYVSWLPPAIY------RSTCAVEVTYFPFDWQNCSL-IFRSQTYNAEEVEFIFAVD 183

  Fly   372 DQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTG---------DVAIEFTLQ 427
            |....|...: ::|.   :||:.....::      |.| ||:::..|         ||.....::
Mouse   184 DDGNTINKID-IDTA---AFTENGEWAID------YCP-GMIRRYEGGSTEGPGETDVIYTLIIR 237

  Fly   428 RNRSFYMTVFYLPLIACQMFLILSFVL--RSTRRSSLILIALLIAAWGLMYMTRYASPH--YVPP 488
            |...||:....:|.:.....::|::.|  ::..:...:.|.:|:|....:::.....|.  ...|
Mouse   238 RKPLFYVINIIVPCVLISGLVLLAYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKIPETSLSVP 302

  Fly   489 MMTAYKVIMMTTTYCYILHICIIWLD--LYPPRSKAPGWLVRVINSNVLRCILG 540
            ::..|.:.:|......::: |:|.|:  |..|.:.|....:|.|...:|..:||
Mouse   303 LLGRYLIFVMVVATLIVMN-CVIVLNVSLRTPTTHATSPRLRQILLELLPRLLG 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 3/6 (50%)
Neur_chan_LBD 212..429 CDD:280998 47/233 (20%)
ChrneXP_006532069.1 LIC 17..476 CDD:273305 79/380 (21%)
Neur_chan_LBD 24..240 CDD:280998 53/256 (21%)
Neur_chan_memb 247..475 CDD:280999 21/111 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.