DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrnd

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_067611.2 Gene:Chrnd MGIID:87893 Length:520 Species:Mus musculus

Alignment Length:352 Identity:74/353 (21%)
Similarity:141/353 (40%) Gaps:35/353 (10%)


  Fly   174 APLVINYLSFSSFGSNTARWFYDCGFD--GYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANL 236
            |.||:..|. .|:|.|..:......|:  ||..::.|:.::|.|.:..||            ..|
Mouse    12 AALVVCALP-GSWGLNEEQRLIQHLFNEKGYDKDLRPVARKEDKVDVALS------------LTL 63

  Fly   237 SSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLN 301
            |::        ::.::....|.|.:.:...|.||||.|...|||::.....|...:|.|.: ||.
Mouse    64 SNL--------ISLKEVEETLTTNVWIDHAWVDSRLQWDANDFGNITVLRLPPDMVWLPEI-VLE 119

  Fly   302 GALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQE-N 365
            .......|:..:..::||.:|.:|.....: ..|.|..|...:|.:...|.::........:| .
Mouse   120 NNNDGSFQISYACNVLVYDSGYVTWLPPAI-FRSSCPISVTYFPFDWQNCSLKFSSLKYTAKEIT 183

  Fly   366 VALIYDDQRKPIAPNEH-VNTPSGWSFTQMSV-VLVENDSQRRYNPKGMMQKMT-GDVAIEFTLQ 427
            ::|..:::.....|.|. :..|.|  ||:... .:|...::...:|...|.... .||.....::
Mouse   184 LSLKQEEENNRSYPIEWIIIDPEG--FTENGEWEIVHRAAKLNVDPSVPMDSTNHQDVTFYLIIR 246

  Fly   428 RNRSFYMTVFYLPLIACQMFLILSFVLR---STRRSSLILIALLIAAWGLMYMTRYASPHYVPPM 489
            |...||:....:|.:.....:.|.|.|.   ..:.|..|.:.|..:.:.|:...|..:.....|:
Mouse   247 RKPLFYIINILVPCVLISFMINLVFYLPGDCGEKTSVAISVLLAQSVFLLLISKRLPATSMAIPL 311

  Fly   490 MTAYKVIMMTTTYCYILHICIIWLDLY 516
            :..:.:..|......:: ||:|.|:::
Mouse   312 VGKFLLFGMVLVTMVVV-ICVIVLNIH 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 7/17 (41%)
Neur_chan_LBD 212..429 CDD:280998 46/221 (21%)
ChrndNP_067611.2 LIC 1..479 CDD:273305 74/353 (21%)
Neur_chan_LBD 28..249 CDD:280998 50/245 (20%)
Neur_chan_memb 256..492 CDD:280999 15/84 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.