DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrnb2

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_033732.2 Gene:Chrnb2 MGIID:87891 Length:501 Species:Mus musculus

Alignment Length:404 Identity:91/405 (22%)
Similarity:155/405 (38%) Gaps:79/405 (20%)


  Fly   188 SNTARWFYDCGFDGYGSEIAPIVKEETKTEKLL--SHLNIQAENASMPANLSSISFHFQTRSL-A 249
            ||:....:..|.....|.:.....||...|.||  |..|.....|:..:.|.::........| :
Mouse     5 SNSMALLFSFGLLWLCSGVLGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLIS 69

  Fly   250 YEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSY 314
            ..:...::.|.:.:...|.|.||.||||||.:::....|...||.|.:.:.|.| ..|      |
Mouse    70 VHEREQIMTTNVWLTQEWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYNNA-DGM------Y 127

  Fly   315 ELMVYAN------GSI-----TLY--AQNLQLASW------CVDSARNWPSERVTCDIELGLNGQ 360
            |:..|:|      |||     .:|  |..:::..:      |....|:|..:|...|:.|     
Mouse   128 EVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVL----- 187

  Fly   361 EGQENVALIYDDQRKPIAPNEHVNTPSG-WSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEF 424
              :.:||.:.|            .|||| |.       ::....:|..||.   .....|:..:|
Mouse   188 --KSDVASLDD------------FTPSGEWD-------IIALPGRRNENPD---DSTYVDITYDF 228

  Fly   425 TLQRNRSFYMTVFYLPLIACQMFLILSFVLRST--RRSSLILIALLIAAWGLMYMTRYASPHYVP 487
            .::|...||.....:|.:......||.|.|.|.  .:.:|.:..||.....|:.:::...|..:.
Mouse   229 IIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLD 293

  Fly   488 -PMMTAYKVI-MMTTTYCYILHICIIWLDLYPP--RSKAPGWLVRVINSNVLRCILGLRFSDSTD 548
             |::..|.:. |:..|:..:..:|::.:....|  .:.|| | |:|:....|..:|.|       
Mouse   294 VPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAP-W-VKVVFLEKLPTLLFL------- 349

  Fly   549 YCDIQENPWHHMAK 562
                 :.|.|..|:
Mouse   350 -----QQPRHRCAR 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 2/3 (67%)
Neur_chan_LBD 212..429 CDD:280998 57/240 (24%)
Chrnb2NP_033732.2 LIC 29..478 CDD:273305 87/381 (23%)
Neur_chan_LBD 29..234 CDD:280998 57/241 (24%)
Neur_chan_memb 241..477 CDD:280999 28/133 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.