DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrnb1

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_033731.3 Gene:Chrnb1 MGIID:87890 Length:501 Species:Mus musculus

Alignment Length:370 Identity:79/371 (21%)
Similarity:141/371 (38%) Gaps:52/371 (14%)


  Fly   203 GSEIAPIVK----EETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSL------L 257
            |:.:||..:    |....:||.|:.:.....|....:...:|.     .|...|..||      :
Mouse    14 GTPLAPGARGSEAEGQLIKKLFSNYDSSVRPAREVGDRVGVSI-----GLTLAQLISLNEKDEEM 73

  Fly   258 QTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANG 322
            .|::::.:.|.|.||.|.|.:...::|.......:|.|.:.:||.. .....|.....::|...|
Mouse    74 STKVYLDLEWTDYRLSWDPAEHDGIDSLRITAESVWLPDVVLLNNN-DGNFDVALDINVVVSFEG 137

  Fly   323 SIT-----LYAQNLQLA------SW--C--VDSARNWPSERVTCDIELGLNGQEGQENVALIYDD 372
            |:.     ||..:..:.      .|  |  |.|:.::.|..|:....|...|:|.||    :|..
Mouse   138 SVRWQPPGLYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVSLKTGLDPEGEERQE----VYIH 198

  Fly   373 QRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVF 437
            :...|...:       |........|::....:|...:|..:    :|.....::|...||:...
Mouse   199 EGTFIENGQ-------WEIIHKPSRLIQLPGDQRGGKEGHHE----EVIFYLIIRRKPLFYLVNV 252

  Fly   438 YLPLIACQMFLILSFVL--RSTRRSSLILIALL-IAAWGLMYMTRYASPHYVPPMMTAYKVI-MM 498
            ..|.|...:..|..|.|  .:..:..|.:.||| :..:.|:...:........|::..|.:. |:
Mouse   253 IAPCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPETSLAVPIIIKYLMFTMV 317

  Fly   499 TTTYCYILHICIIWLDLYPPRS-KAPGWLVRVINSNVLRCILGLR 542
            ..|:..||.:.::.|....|.: :.|.| ||.|..:.|...|||:
Mouse   318 LVTFSVILSVVVLNLHHRSPHTHQMPFW-VRQIFIHKLPPYLGLK 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 47/238 (20%)
Chrnb1NP_033731.3 LIC 24..488 CDD:273305 76/361 (21%)
Neur_chan_LBD 27..245 CDD:280998 47/239 (20%)
Neur_chan_memb 252..487 CDD:280999 27/112 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.