DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrna6

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_067344.2 Gene:Chrna6 MGIID:106213 Length:494 Species:Mus musculus

Alignment Length:383 Identity:82/384 (21%)
Similarity:149/384 (39%) Gaps:44/384 (11%)


  Fly   177 VINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLN---IQAENASMPANLSS 238
            ::|.....:..|....|.  |||............||....:|.:|.|   ...||.|.|     
Mouse     1 MLNSRDQGNLHSGLCLWL--CGFLALFKGSTGCESEEQLFHRLFAHYNRFIRPVENVSDP----- 58

  Fly   239 ISFHFQ---TRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVL 300
            ::.||:   |:....::.:.:::|.:.:...|:|.||.|.|.::..:|:...|...||||.:.:.
Mouse    59 VTVHFELAITQLANVDEVNQIMETNLWLRHIWKDYRLRWDPTEYDGIETLRVPADNIWKPDIVLY 123

  Fly   301 NGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQEN 365
            |.|:... ||....:.::..:|.|| :.......|.|......:|.:...|.::.|....:..|.
Mouse   124 NNAVGDF-QVEGKTKALLKYDGVIT-WTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEI 186

  Fly   366 VALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQR-----RYNPKGMMQKMTGDVAIEFT 425
            ..||...:         |:....|..::..:|    |:..     :||   ..:::..|:...|.
Mouse   187 DLLIIGSK---------VDMNDFWENSEWEIV----DASGYKHDIKYN---CCEEIYTDITYSFY 235

  Fly   426 LQRNRSFYMTVFYLPLIACQMFLILSFVLRST--RRSSLILIALLIAAWGLMYMTR-YASPHYVP 487
            ::|...||.....:|.:......:|.|.|.|.  .:.:|.:..||.....|:.:|. ..|...|.
Mouse   236 IRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVI 300

  Fly   488 PMMTAYKVIMMTTTYCYILHICIIWLDLY---PPRSKAPGWLVRVINSNVLRCILGLR 542
            |::..|.:..|......|: :.:..|:::   |.....|.| |:.|.......||.:|
Mouse   301 PLVGEYLLFTMIFVTLSIV-VTVFVLNIHYRTPATHTMPKW-VKTIFLQAFPSILMMR 356

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 2/14 (14%)
Neur_chan_LBD 212..429 CDD:280998 49/228 (21%)
Chrna6NP_067344.2 LIC 15..484 CDD:273305 80/370 (22%)
Neur_chan_LBD 34..240 CDD:280998 49/229 (21%)
Neur_chan_memb 247..483 CDD:280999 25/113 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.