DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and CHRND

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_000742.1 Gene:CHRND HGNCID:1965 Length:517 Species:Homo sapiens

Alignment Length:327 Identity:61/328 (19%)
Similarity:129/328 (39%) Gaps:40/328 (12%)


  Fly   201 GYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMM 265
            ||..|:.|:..:|            ::.:.::...||::        ::.::....|.|.:.:..
Human    37 GYNKELRPVAHKE------------ESVDVALALTLSNL--------ISLKEVEETLTTNVWIEH 81

  Fly   266 HWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQN 330
            .|.|:||.|..|:||::.....|...:|.|.: ||........|:..|..::||..|.: .:...
Human    82 GWTDNRLKWNAEEFGNISVLRLPPDMVWLPEI-VLENNNDGSFQISYSCNVLVYHYGFV-YWLPP 144

  Fly   331 LQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGW------ 389
            ....|.|..|...:|.:...|.::........:|....:..|.:      |:...|..|      
Human   145 AIFRSSCPISVTYFPFDWQNCSLKFSSLKYTAKEITLSLKQDAK------ENRTYPVEWIIIDPE 203

  Fly   390 SFTQMSV-VLVENDSQRRYNPKGMMQKMT-GDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSF 452
            .||:... .:|...::...:|:..:...: .|:.....::|...||:....:|.:.....:.|.|
Human   204 GFTENGEWEIVHRPARVNVDPRAPLDSPSRQDITFYLIIRRKPLFYIINILVPCVLISFMVNLVF 268

  Fly   453 VL--RSTRRSSLILIALLI-AAWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLD 514
            .|  .|..::|:.:..||. :.:.|:...|..:.....|::..:.:..|......:: ||:|.|:
Human   269 YLPADSGEKTSVAISVLLAQSVFLLLISKRLPATSMAIPLIGKFLLFGMVLVTMVVV-ICVIVLN 332

  Fly   515 LY 516
            ::
Human   333 IH 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 39/225 (17%)
CHRNDNP_000742.1 Neur_chan_LBD 25..246 CDD:308532 43/237 (18%)
Neur_chan_memb 253..489 CDD:308533 16/84 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.