DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and CHRNB3

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_000740.1 Gene:CHRNB3 / 1142 HGNCID:1963 Length:458 Species:Homo sapiens


Alignment Length:389 Identity:75/389 - (19%)
Similarity:141/389 - (36%) Gaps:97/389 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 FDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHM 263
            |.||...:.|:: ....|.|:...|.|                   ::.:..::.:.|:.|.:.:
Human    37 FQGYQKWVRPVL-HSNDTIKVYFGLKI-------------------SQLVDVDEKNQLMTTNVWL 81

  Fly   264 MMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYA 328
            ...|.|.:|.|.|:|:|.:.|.:.|...:|.|.:.:...|.......|.: :::|.:||:: ::.
Human    82 KQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMT-KVIVKSNGTV-VWT 144

  Fly   329 QNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSF-- 391
            ......|.|......:|.:|..|.::.|                               .|::  
Human   145 PPASYKSSCTMDVTFFPFDRQNCSMKFG-------------------------------SWTYDG 178

  Fly   392 TQMSVVLVENDSQRR----------YNPKGMMQKMTGDV------AIEFTLQRNRSFYMTVFYLP 440
            |.:.::|:..:..|:          .|.|||.......|      ...|.|:|...||.....:|
Human   179 TMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRLPLFYTLFLIIP 243

  Fly   441 LIACQMFLILSFVLRSTRRSSL-----ILIALLIAAWGLMYMTRYASPHYVPPMMTAYKV-IMMT 499
            .:......:|.|.|.|.....|     :|::|.:  :.|:......|...|.|::..|.: ||:.
Human   244 CLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTV--FLLVIEEIIPSSSKVIPLIGEYLLFIMIF 306

  Fly   500 TTYCYILHICIIWL-----DLYPPRSKAPGWLVRVINSNV--LRCILGLRFSDSTDYCDIQENP 556
            .|...|:.:.:|.:     ..|.|  .|| |:.|:....:  |.|:        .|:.|...:|
Human   307 VTLSIIVTVFVINVHHRSSSTYHP--MAP-WVKRLFLQKLPKLLCM--------KDHVDRYSSP 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 39/234 (17%)
CHRNB3NP_000740.1 Neur_chan_LBD 23..449 CDD:332142 75/389 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.