DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and CHRNA4

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_000735.1 Gene:CHRNA4 HGNCID:1958 Length:627 Species:Homo sapiens

Alignment Length:364 Identity:81/365 (22%)
Similarity:146/365 (40%) Gaps:35/365 (10%)


  Fly   212 EETKTEKLLSHLNIQAENASMP-ANLSSISFHFQTRSLA----YEQTSSLLQTRMHMMMHWRDSR 271
            ||...:||.|..|    ..|.| ||:|.:.......|:|    .::.:.::.|.:.:...|.|.:
Human    37 EERLLKKLFSGYN----KWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYK 97

  Fly   272 LVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASW 336
            |.|.|.|:.::.|...|...||:|.:.:.|.|..... |....:..::.:|.:......:..:|.
Human    98 LRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFA-VTHLTKAHLFHDGRVQWTPPAIYKSSC 161

  Fly   337 CVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEH--VNTPSGWSFTQMSVVLV 399
            .:| ...:|.::..|.::.|          :..||..:..:. |.|  |:....|...:..:|  
Human   162 SID-VTFFPFDQQNCTMKFG----------SWTYDKAKIDLV-NMHSRVDQLDFWESGEWVIV-- 212

  Fly   400 ENDSQRRYNPK--GMMQKMTGDVAIEFTLQRNRSFYMTVFYLP--LIACQMFLILSFVLRSTRRS 460
              |:...||.:  ....::..|:...|.::|...||.....:|  ||:|...|:.........:.
Human   213 --DAVGTYNTRKYECCAEIYPDITYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKI 275

  Fly   461 SLILIALLIAAWGLMYMTR-YASPHYVPPMMTAYKVI-MMTTTYCYILHICIIWLDLYPPRSKA- 522
            :|.:..||.....|:.:|. ..|...|.|::..|.:. |:..|...::.:.::.:....||:.. 
Human   276 TLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTM 340

  Fly   523 PGWLVRVINSNVLRCILGLRFSDSTDYCDIQENPWHHMA 561
            |.|:.||....|.|.:|..|.|...|.|.......|.||
Human   341 PTWVRRVFLDIVPRLLLMKRPSVVKDNCRRLIESMHKMA 379

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 47/226 (21%)
CHRNA4NP_000735.1 Neur_chan_LBD 37..243 CDD:280998 47/227 (21%)
Neur_chan_memb 250..618 CDD:280999 32/131 (24%)
Ten_N <423..>572 CDD:284015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.