DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and CHRNA2

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_000733.2 Gene:CHRNA2 HGNCID:1956 Length:529 Species:Homo sapiens

Alignment Length:364 Identity:76/365 (21%)
Similarity:145/365 (40%) Gaps:35/365 (10%)


  Fly   214 TKTE-KLLSHL----NIQAENASMPANLSSISFHFQTRSLA-YEQTSSLLQTRMHMMMHWRDSRL 272
            |:|| :|..||    |..|......:::..:.|......|. .::.:.::.|.:.:...|.|.:|
Human    56 TETEDRLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKL 120

  Fly   273 VWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWC 337
            .|.|.|||::.|...|...||.|.:.:.|.| .....|....:..:::.|::......:..:|..
Human   121 RWNPTDFGNITSLRVPSEMIWIPDIVLYNNA-DGEFAVTHMTKAHLFSTGTVHWVPPAIYKSSCS 184

  Fly   338 VDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEH-VNTPSGWSFTQMSVVLVEN 401
            :| ...:|.::..|.::.|          :..||..:..:...|. |:....|...:.::|    
Human   185 ID-VTFFPFDQQNCKMKFG----------SWTYDKAKIDLEQMEQTVDLKDYWESGEWAIV---- 234

  Fly   402 DSQRRYNPK--GMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRST--RRSSL 462
            ::...||.|  ....::..||...|.::|...||.....:|.:......:|.|.|.|.  .:.:|
Human   235 NATGTYNSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITL 299

  Fly   463 ILIALLIAAWGLMYMTR-YASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLY---PPRSKAP 523
            .:..||.....|:.:|. ..|...|.|::..|.:..|......|: |.:..|:::   |.....|
Human   300 CISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIV-ITVFVLNVHHRSPSTHTMP 363

  Fly   524 GWLVRVINSNVLRCILGLRFSDSTDYCD---IQENPWHH 559
            .|:...:...|.|.:|..|.....:.|.   ::.:|.:|
Human   364 HWVRGALLGCVPRWLLMNRPPPPVELCHPLRLKLSPSYH 402

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 46/224 (21%)
CHRNA2NP_000733.2 LIC 57..522 CDD:273305 75/364 (21%)
Neur_chan_LBD 59..265 CDD:280998 44/222 (20%)
Neur_chan_memb 272..520 CDD:280999 28/133 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.