DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrna5

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_006510836.1 Gene:Chrna5 MGIID:87889 Length:467 Species:Mus musculus

Alignment Length:459 Identity:78/460 (17%)
Similarity:155/460 (34%) Gaps:150/460 (33%)


  Fly   199 FDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLA-YEQTSSLLQTRMH 262
            |:.|...:.|:   |..::|:                  .|.|......|. .::.:.|:.|.:.
Mouse    55 FEDYEKWVRPV---EHLSDKI------------------KIKFGLAISQLVDVDEKNQLMTTNVW 98

  Fly   263 MMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVL---NGALQSMGQVLQSYELMVYANGSI 324
            :...|.|.:|.|.|:|:|.::....|...:|.|.:.:.   :|..:.     .|.:.:|..||::
Mouse    99 LKQEWIDVKLRWNPDDYGGIKIIRVPSDSLWIPDIVLFDNADGRFEG-----ASTKTVVRYNGTV 158

  Fly   325 TLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGW 389
            | :.|.....|.|......:|.:...|.::.|                               .|
Mouse   159 T-WTQPANYKSSCTIDVTFFPFDLQNCSMKFG-------------------------------SW 191

  Fly   390 SF--TQMSVVLVENDSQRR-YNPKGMMQKMT-----GD----------VAIEFTLQRNRSFYMTV 436
            ::  :|:.::|.:.|..|. :...|..:.|:     |:          :...|.::|...||...
Mouse   192 TYDGSQVDIILEDQDVDRTDFFDNGEWEIMSAMGSKGNRTDSCCWYPCITYSFVIKRLPLFYTLF 256

  Fly   437 FYLPLIACQMFLILSFVLRSTRRSSL-----ILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVI 496
            ..:|.|......::.|.|.|.....:     :|::|.:  :.|:......|...|.|::..|.|.
Mouse   257 LIIPCIGLSFLTVVVFYLPSNEGEKISLCTSVLVSLTV--FLLVIEEIIPSSSKVIPLIGEYLVF 319

  Fly   497 --------MMTTTYCYILH-------------ICIIWLDLYPP----RSKAPGWL---------- 526
                    :|.|.:...:|             :..|:|...|.    ||.|..:.          
Mouse   320 TMIFVTLSIMVTVFAINIHHRSSSTHNAMAPWVRKIFLHKLPKLLCMRSHADRYFTQREEAEKDG 384

  Fly   527 --------------VRVINSNVLRCILGLRFSDSTDYCDIQENPWHHMAKILNNLSSILVIITFA 577
                          :|.|..:|::         ..|..::.|: |..:|::|:.    :.:.||.
Mouse   385 GPKSRNTLEAALDCIRYITRHVVK---------ENDVREVVED-WKFIAQVLDR----MFLWTFL 435

  Fly   578 IVDI 581
            :|.|
Mouse   436 LVSI 439

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 39/239 (16%)
Chrna5XP_006510836.1 LIC 41..448 CDD:273305 78/460 (17%)
Neur_chan_LBD 47..250 CDD:280998 42/253 (17%)
Neur_chan_memb 257..446 CDD:280999 34/200 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.