DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrna3

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_660111.3 Gene:Chrna3 MGIID:87887 Length:499 Species:Mus musculus

Alignment Length:382 Identity:76/383 (20%)
Similarity:143/383 (37%) Gaps:48/383 (13%)


  Fly   176 LVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSIS 240
            ||:..|..:| .|......:...|:.|...|.|:.                  |.|.|.   .|.
Mouse    15 LVLMLLPVAS-ASEAEHRLFQYLFEDYNEIIRPVA------------------NVSHPV---IIQ 57

  Fly   241 FHFQTRSLA-YEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGAL 304
            |......|. .::.:.:::|.:.:...|.|.:|.|||.|:..:|....|..:||||.:.:.|.| 
Mouse    58 FEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNA- 121

  Fly   305 QSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALI 369
            ....||....:.::...|.:|.....: ..|.|......:|.:...|.::.|          :..
Mouse   122 DGDFQVDDKTKALLKYTGEVTWIPPAI-FKSSCKIDVTYFPFDYQNCTMKFG----------SWS 175

  Fly   370 YDDQR-KPIAPNEHVNTPSGWSFTQMSVVLVEN-DSQRRYNPKGMMQKMTGDVAIEFTLQRNRSF 432
            ||..: ..:.....:|....|...:.:::.... ..:.:||   ..:::..|:.....::|...|
Mouse   176 YDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHEIKYN---CCEEIYQDITYSLYIRRLPLF 237

  Fly   433 YMTVFYLPLIACQMFLILSFVLRST--RRSSLILIALLIAAWGLMYMTR-YASPHYVPPMMTAYK 494
            |.....:|.:......:|.|.|.|.  .:.:|.:..||.....|:.:|. ..|...|.|::..|.
Mouse   238 YTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYL 302

  Fly   495 VIMMTTTYCYILHICIIWLDLY---PPRSKAPGWLVRVINSNVLRCILGLRFSDSTD 548
            :..|......|: |.:..|:::   |.....|.| |:.:..|:|..::.:....||:
Mouse   303 LFTMIFVTLSIV-ITVFVLNVHYRTPTTHTMPTW-VKAVFLNLLPRVMFMTRPTSTE 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 5/15 (33%)
Neur_chan_LBD 212..429 CDD:280998 39/220 (18%)
Chrna3NP_660111.3 LIC 24..490 CDD:273305 73/374 (20%)
LGIC_ECD_nAChR_A3 29..235 CDD:349817 43/242 (18%)
Cys-loop 153..167 CDD:349817 2/14 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.