DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrnb3

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_775304.1 Gene:Chrnb3 MGIID:106212 Length:464 Species:Mus musculus

Alignment Length:469 Identity:84/470 (18%)
Similarity:160/470 (34%) Gaps:151/470 (32%)


  Fly   199 FDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLA-YEQTSSLLQTRMH 262
            |.||...:.|::                  |:|   ::..:.|..:...|. .::.:.|:.|.:.
Mouse    43 FQGYQKCVRPVL------------------NSS---DIIKVYFGLKISQLVDVDEKNQLMTTNVW 86

  Fly   263 MMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLY 327
            :...|.|.:|.|.|||:|.:.|.:.|...:|.|.:.:...|.......|.: :.:|.::|::: :
Mouse    87 LKQEWTDQKLRWNPEDYGGINSIKVPSESLWLPDIVLFENADGRFEGSLMT-KAIVKSSGTVS-W 149

  Fly   328 AQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSF- 391
            .......|.|......:|.::..|.::.|                               .|:: 
Mouse   150 TPPASYKSSCTMDVTFFPFDKQNCSMKFG-------------------------------SWTYD 183

  Fly   392 -TQMSVVLVENDSQRR----------YNPKGMM-QKMTG-----DVAIEFTLQRNRSFYMTVFYL 439
             |.:.::|:..:..|:          .|.|||. .:..|     .|...|.|:|...||.....:
Mouse   184 GTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRREGFYSYPFVTYSFVLRRLPLFYTLFLII 248

  Fly   440 PLIACQMFLILSFVLRSTRRSSL-----ILIALLIAAWGLMYMTRYASPHYVPPMMTAYKV-IMM 498
            |.:......:|.|.|.|.....|     :|::|.:  :.|:......|...|.|::..|.: ||:
Mouse   249 PCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTV--FLLVIEEIIPSSSKVIPLIGEYLLFIMI 311

  Fly   499 TTTYCYILHICII---------------------------WLDLYPP----------------RS 520
            ..|...|:.:.:|                           ||.:..|                |.
Mouse   312 FVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLEKLPRWLCMKDPRDRFSFPDGTESKGTVRG 376

  Fly   521 KAPGWLVRVINSNVLRCILGL--RFSDSTDYCD------------IQENPWHHMAKILNN----- 566
            |.||...:...|:..|.::..  :.|:|..|..            :|:  |..:|::|:.     
Mouse   377 KFPGKKKQTPTSDGERVLVAFLEKASESIRYISRHVKKEHFISQVVQD--WKFVAQVLDRIFLWL 439

  Fly   567 ------LSSILVII 574
                  |.|:|:.|
Mouse   440 FLTASVLGSVLIFI 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 40/236 (17%)
Chrnb3NP_775304.1 LIC 6..455 CDD:273305 84/470 (18%)
Neur_chan_LBD 35..239 CDD:280998 44/250 (18%)
Neur_chan_memb 246..452 CDD:280999 37/210 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.