DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrng

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001241879.1 Gene:chrng ZFINID:ZDB-GENE-030131-3805 Length:540 Species:Danio rerio

Alignment Length:373 Identity:66/374 (18%)
Similarity:134/374 (36%) Gaps:83/374 (22%)


  Fly   201 GYGSEIAPIVKEE----TKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRM 261
            ||...|.|:...|    .|.:..|::|                        ::..:....|.|.:
Zfish    37 GYNKNIRPVESHEDIIDVKIKMTLTNL------------------------ISLNEKEETLTTCV 77

  Fly   262 HMMMHWRDSRLVWKP----EDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYAN- 321
            .:.|.|||.||.|..    |.:.::.....|...||.|.:.:.|       .|...:|:.:||| 
Zfish    78 WIEMQWRDYRLRWANRTGFEVYENITRMRLPSKTIWLPDIGLEN-------NVDGRFEVALYANT 135

  Fly   322 -----GSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNE 381
                 ||:......:..:| |......:|.:...|.:..........|...::.|:.        
Zfish   136 LIDPDGSVYWLPPAIYRSS-CAIKVNYFPFDWQNCSMVFRSQTYNSNEITLMLSDED-------- 191

  Fly   382 HVNTPSGW------SFTQMSVVLVENDS-----QRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMT 435
              |....|      :||:....::::..     .:||.|..:..:   ::.....:||...||:.
Zfish   192 --NVTMEWIEIDPEAFTENGEWMIKHRPAKKVINKRYRPDELEHQ---EIIFFLIIQRKPLFYVI 251

  Fly   436 VFYLPLIACQMFLILSFVL-----RSTRRSSLILIALLIAAWGLMYMTRYASPH--YVPPMMTAY 493
            ...:|   |.:|..|..::     ::..:...:.|.:|:.....:::.....|.  ...|::..|
Zfish   252 NIIVP---CVLFSSLGLLVYFLPAKAGGQKCTMTICILLGQTVFLFLIAKKVPETSQAVPLIGKY 313

  Fly   494 KVIMMTTTYCYILHICIIWLD--LYPPRSKAPGWLVRVINSNVLRCIL 539
            .:.:|:.|...::: |::.|:  |..|.:......:|.:..|:|..:|
Zfish   314 LMFVMSVTTITVMN-CVVVLNVSLRTPNTHPMSNTIRKVLLNILPRVL 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 41/242 (17%)
chrngNP_001241879.1 LIC 21..511 CDD:273305 66/374 (18%)
Neur_chan_LBD 27..246 CDD:280998 45/254 (18%)
Neur_chan_memb 253..509 CDD:280999 19/113 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.