DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrne

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_002941867.3 Gene:chrne XenbaseID:XB-GENE-979686 Length:505 Species:Xenopus tropicalis

Alignment Length:378 Identity:73/379 (19%)
Similarity:157/379 (41%) Gaps:63/379 (17%)


  Fly   213 ETKTEKLLSHLNIQAENASMPA----NLSSISFHFQ-TRSLAYEQTSSLLQTRMHMMMHWRDSRL 272
            |::..:|:.:|....::.:.|:    ::..:|.... |..:...:....|.|.:.:.:.|:|.||
 Frog    21 ESEESRLIKYLFTNYDSKARPSKGIDDVVPVSLKLTLTNLIDLNEKEETLTTNVWVQIAWQDDRL 85

  Fly   273 VWKPEDFGSLESFEHPDLRIWKPHM---NVLNGALQSMGQVLQSYELMVYANGSI--TLYAQNLQ 332
            .|..:.:|.:...:.|...:|.|.:   |.::|          ::|:..|||..:  |.|...|.
 Frog    86 TWNEQXYGGMPLVQVPHDMMWLPEIVLENNIDG----------NFEVAYYANVLVHSTGYIYWLP 140

  Fly   333 LASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNE---HV--NTPSGWSFT 392
            .|.:           |.||.||:.....:.| |.:|::  :.|..:.|:   |:  :..:|..|.
 Frog   141 PAIF-----------RSTCSIEITYFPFDWQ-NCSLVF--RSKTYSANDIDLHLVADDETGLPFD 191

  Fly   393 QMSV-----------VLVENDSQRRYNPKGMMQKMT-GDVAIEFTLQRNRSFYMTVFYLPLIACQ 445
            |:.:           .::...:::..|||...:.:. .::.....:||...||:....:|.:...
 Frog   192 QVDIDREAFTENGEWAIMHRPARKIVNPKYSKEDLRYQEIVFILIIQRKPLFYIINIIVPCVLIS 256

  Fly   446 MFLILSFVL--RSTRRSSLILIALLIAAWGLMYMTRYASPH--YVPPMMTAYKVIMMTTTYCYIL 506
            ..::|.:.|  ::..:...:.|::|:|....:::.....|.  ...|::..|.:.:|..:...:|
 Frog   257 SLVVLVYFLPAKAGGQKCTVSISVLLAQTVFLFLIAQMIPETSLSVPLIGKYLMFVMFVSTLIVL 321

  Fly   507 HICIIWLD--LYPPRSKAPGWLVRVINSNVLRCILGLRFSDSTDYCDI-QENP 556
            . |:|.|:  |..|.:......|:.:...||...:.||    .:.||. :|.|
 Frog   322 S-CVIVLNVSLRSPSTHTLSSKVKHMLLEVLPQFIHLR----VEPCDEGEETP 369

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 46/243 (19%)
chrneXP_002941867.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.