DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrna6

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_002942944.3 Gene:chrna6 XenbaseID:XB-GENE-6033398 Length:463 Species:Xenopus tropicalis

Alignment Length:333 Identity:75/334 (22%)
Similarity:138/334 (41%) Gaps:43/334 (13%)


  Fly   212 EETKTEKLLSHLNIQ---AENASMPANLSSISFHFQ---TRSLAYEQTSSLLQTRMHMMMHWRDS 270
            ||...:|||:..|..   .||.|.|     :..||:   |:.:..::.:.:|:|.:.:...|.|.
 Frog    31 EEKLFQKLLARYNQHIRPVENVSDP-----VMVHFEVAITQLVNVDEVNQILETNLWLRHIWNDY 90

  Fly   271 RLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLAS 335
            :|.|.|:::..:|....|..:||||.:.:.|.|:... ||....:.:|..||.|| ::......|
 Frog    91 KLQWNPKEYDGIEFMRIPADKIWKPDIVLYNNAVGDF-QVEGKSKALVKYNGLIT-WSPPAIFKS 153

  Fly   336 WCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIA-PNEHVNTPSGWSFTQMSVVLV 399
            .|......:|.:...|.::.|          :..||..:..:| ....|:....|..::..:|  
 Frog   154 SCPMDITFFPFDHQNCSMKFG----------SWSYDKAKIDLAIIGSKVDMKDFWENSEWEIV-- 206

  Fly   400 ENDSQR-----RYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRST-- 457
              |:..     :||   ..:::..|:...|.::|...||.....:|.:......:|.|.|.|.  
 Frog   207 --DASGFKHDIKYN---CCEEIYTDITYSFYIRRLPMFYTINLIMPCLFLSFLTVLVFYLPSDCG 266

  Fly   458 RRSSLILIALLIAAWGLMYMTR-YASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLY---PP 518
            .:.:|.:..||.....|:.:|. ..|...|.|::..|.:..|......|: :.:..|:::   |.
 Frog   267 EKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIV-VTVFVLNIHYRTPT 330

  Fly   519 RSKAPGWL 526
            ..|.|.|:
 Frog   331 THKMPMWV 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 52/229 (23%)
chrna6XP_002942944.3 Neur_chan_LBD 31..237 CDD:280998 52/230 (23%)
Neur_chan_memb 244..452 CDD:280999 21/97 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.