DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrnb3

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_002942943.1 Gene:chrnb3 XenbaseID:XB-GENE-5793509 Length:460 Species:Xenopus tropicalis

Alignment Length:403 Identity:77/404 (19%)
Similarity:148/404 (37%) Gaps:82/404 (20%)


  Fly   193 WFYDCGFDGYGSEIAPIVK-EETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLA-YEQTSS 255
            :|.:.||    ::..|:.: |:....||.:...........|.:...::|..:...|. .::...
 Frog    15 YFINSGF----AKFHPLAEIEDALLRKLFAGYQKWVRPVLNPNSTIKVNFGLKISQLVDVDEKKQ 75

  Fly   256 LLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYA 320
            |:.|.:.:...|.|.:|.|.|:|:|.:.....|...:|.|.:.:...|.......|.:..::.| 
 Frog    76 LMTTNVWLRQEWMDMKLRWNPKDYGGITYIRVPSESLWLPDIVLFENADGRFEGSLMTKAIIKY- 139

  Fly   321 NGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNT 385
            :|::| :.......|.|......:|.:|..|.::.|                             
 Frog   140 DGTVT-WTPPASYKSSCTMDVTFFPFDRQNCSMKFG----------------------------- 174

  Fly   386 PSGWSF--TQMSVVLVENDSQRR----------YNPKGMMQKMTGD-------VAIEFTLQRNRS 431
              .|::  ..:.::|::.:..|:          .|..| ::.|..|       :...|.|:|...
 Frog   175 --SWTYDGNMVDLILLDENVDRKDFFDNGEWDILNATG-LKGMRKDGLYSYPFITYSFVLRRLPL 236

  Fly   432 FYMTVFYLPLIACQMFLILSFVLRSTRRSSL-----ILIALLIAAWGLMYMTRYASPHYVPPMMT 491
            ||.....:|.:......:|.|.|.|.....|     :|::|.:  :.|:......|...|.|::.
 Frog   237 FYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTV--FLLVIEEIIPSSSKVIPLIG 299

  Fly   492 AYKV-IMMTTTYCYILHICIIWLD-----LYPPRSKAPGWLVRVINSNV--LRCILG----LRFS 544
            .|.: ||:..|...|:.:.:|.:.     .|.|  .|| |:.|:....:  |.|:.|    ..|.
 Frog   300 EYLLFIMIFVTLSIIVTVFVINVHHRSSATYHP--MAP-WVKRLFLEKLPKLLCMKGHVDRFSFF 361

  Fly   545 DS-TDYCDIQENP 556
            || :|....:..|
 Frog   362 DSESDVSSAKSKP 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 39/237 (16%)
chrnb3XP_002942943.1 LIC 2..451 CDD:273305 77/404 (19%)
Neur_chan_LBD 31..235 CDD:280998 39/238 (16%)
Neur_chan_memb 242..448 CDD:280999 32/139 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.