DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrna5

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_002937929.1 Gene:chrna5 XenbaseID:XB-GENE-5755296 Length:476 Species:Xenopus tropicalis

Alignment Length:500 Identity:101/500 (20%)
Similarity:171/500 (34%) Gaps:135/500 (27%)


  Fly   159 IPGFKKEPLLQFIDEAPLVINYLSFSSFGSNTARWFYDC-----GFDGYGSEIAPIVKEETKTEK 218
            :||.:::..:  |...|....||          .|.:.|     |..|. ||.:.|.|.|.:..|
 Frog     3 LPGTEQKDCV--IQRMPWCAEYL----------LWLFLCLDILHGACGI-SEPSYIAKSEDRLFK 54

  Fly   219 LL-------------SHLNIQAENASMPANLSSISFHFQ-TRSLAYEQTSSLLQTRMHMMMHWRD 269
            .|             .|||          :...:.|... |:.:..::.:.|:.|.:.:...|.|
 Frog    55 YLFQQQDYQRWVRPVEHLN----------DTVKVKFGLAITQLVDVDEKNQLMTTNVWLKQEWVD 109

  Fly   270 SRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGA-LQSMGQVLQSYELMVYANGSITLYAQNLQL 333
            .:|.|.|.:|..:.|...|...||.|.:.:.:.| .:..|.|.::   :|..:|:|. :......
 Frog   110 VKLRWDPNEFAGITSIRVPSDSIWIPDIVLYDNADGRFEGSVTKA---VVRYDGTIN-WTPPANY 170

  Fly   334 ASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVL 398
            .|.|......:|.:...|.::.|....:|.: |.:|.:|.        ||:....:...:..:| 
 Frog   171 KSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQ-VDIILEDY--------HVDKRDFFDNGEWEIV- 225

  Fly   399 VENDSQRRYNPKGMMQKMTGD------VAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRST 457
                     |..|.....|..      :...|.::|...||.....:|.|......||.|.|.|.
 Frog   226 ---------NATGNKGNRTDGCCFYPYITYSFIIKRLPLFYTLFLIIPCIGLSFLTILVFYLPSN 281

  Fly   458 RRSSL-----ILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVI-MMTTTYCYILHICII----- 511
            ....:     :|::|.:  :.|:......|...|.|::..|.|. |:..|...:|.:..|     
 Frog   282 EGEKISLCTSVLVSLTV--FLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIVLTVFAINIHNR 344

  Fly   512 ----------W------------------LDLYPPRSKAPGWLVRVINS--NVLRCILGLRFSDS 546
                      |                  :|.|..|....| .||...|  |.|...|     ||
 Frog   345 SSATHNAMAPWVRKIFLHKLPKLLCMRSHVDRYFTRKDETG-KVRGPESSRNTLEAAL-----DS 403

  Fly   547 TDYC--------DIQE--NPWHHMAKILNNLSSILVIITFAIVDI 581
            ..|.        ::||  ..|..:|::|:.    :.:.||.:|.:
 Frog   404 IRYITRHVMKEHEVQEVVEDWKFVAQVLDR----MFLWTFLLVSV 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 6/32 (19%)
Neur_chan_LBD 212..429 CDD:280998 44/238 (18%)
chrna5XP_002937929.1 LIC 19..453 CDD:273305 97/482 (20%)
Neur_chan_LBD 49..254 CDD:280998 44/238 (18%)
Neur_chan_memb 261..451 CDD:280999 41/196 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.