DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrna1

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_002934647.1 Gene:chrna1 XenbaseID:XB-GENE-977139 Length:457 Species:Xenopus tropicalis

Alignment Length:472 Identity:93/473 (20%)
Similarity:169/473 (36%) Gaps:120/473 (25%)


  Fly   181 LSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQT 245
            |.|||  .:.:|...|. |..|...:.|:...:.|....|....||..|.               
 Frog    17 LVFSS--EDESRLINDL-FKSYNKVVRPVKAFKDKVVVTLGLQLIQLINV--------------- 63

  Fly   246 RSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQV 310
                 ::.:.::.|.:.:...|.|..|.|.|||:|.::........||:|.:.:.|.|......|
 Frog    64 -----DEVNQIVTTNVRLKQQWEDVHLKWNPEDYGGIKKVRISSGDIWRPDIVLYNNADGDFAIV 123

  Fly   311 LQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRK 375
            .::..|:.| .|.| ::.......|:|......:|.:...|.::||....:|  ::.:|..:..:
 Frog   124 QETKVLLDY-TGKI-IWTPPAIFKSYCEMIVTYFPFDLQNCSMKLGTWTYDG--SLVVINPESDR 184

  Fly   376 PIAPN------EHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYM 434
            |...|      .::....||...    |..:...:..|.          |:...|.|||...:::
 Frog   185 PDLSNFMESGEWYMKDYRGWKHW----VYYDCCPETPYL----------DITYHFLLQRLPLYFI 235

  Fly   435 T---------------VFYLP-------------LIACQMFLILSFVLRSTRRSSLILI------ 465
            .               |||||             |::..:||::...|..:..|::.||      
 Frog   236 VNVVIPCLLFSFLTGLVFYLPTDSGEKITLSVSVLLSLVVFLLVIVELIPSTSSAVPLIGKYMLF 300

  Fly   466 -------ALLIAAWGLMYMTRYASP--HYVPPMM------TAYKVIMMTT------------TYC 503
                   :::|..  ::..|.:.||  |.:|..:      |..:|:..:|            .:.
 Frog   301 TMVFVITSIVITV--IVINTHHRSPSTHIMPQWLKKIFIETIPRVMFFSTMKRPAQDQQKKKIFT 363

  Fly   504 YILHICIIWLDLYPPRSKAPGWLVRVINSNVLRCILGLRFSDSTDYCDIQEN----PWHHMAKIL 564
            ..:.|..|...|.|...|....:::  |.:|...|.|.::...|...|.:.|    .|..:|.:|
 Frog   364 EDIDISDISGKLGPAAVKYQSPILK--NPDVKSAIEGAKYIAETMKSDQESNKASEEWKFVAMVL 426

  Fly   565 NNLSSILVIITFAIVDI 581
            ::    |::..|.||.|
 Frog   427 DH----LLLAVFMIVCI 439

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 4/10 (40%)
Neur_chan_LBD 212..429 CDD:280998 43/223 (19%)
chrna1XP_002934647.1 LIC 21..447 CDD:273305 90/469 (19%)
Neur_chan_LBD 24..231 CDD:280998 48/246 (20%)
Neur_chan_memb 238..446 CDD:280999 41/211 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.