DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrng

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001096503.1 Gene:chrng XenbaseID:XB-GENE-990010 Length:510 Species:Xenopus tropicalis

Alignment Length:386 Identity:73/387 (19%)
Similarity:147/387 (38%) Gaps:51/387 (13%)


  Fly   211 KEETKTEKLLSHLNIQAENASMPANLSSISFHFQ-TRSLAYEQTSSLLQTRMHMMMHWRDSRLVW 274
            :||.....|:.:.|.....|....::.|:|.... |..::..:....|.|.:.:.:.|||.||.|
 Frog    20 EEEGLLNDLMKNYNKNLRPAEKDGDIVSVSIKLTLTNLISLNEREEALTTNVWVEVQWRDYRLSW 84

  Fly   275 KPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQL------ 333
            .|.::..:.....|...:|.|.:.:.|       .|..::::.:|||   ||.:.:..:      
 Frog    85 DPNEYYGISMMRIPSTSVWLPDVGLEN-------NVDGTFDIALYAN---TLVSSDGSMYWLPPA 139

  Fly   334 --ASWCVDSARNWPSERVTCDIELGLNGQEGQE-NVALIYDDQR-KPIAPNEHVNTPSG-WSFTQ 393
              .|.|......:|.:...|.:..........| .:.|..|:|. :.|..:....|.:| |:...
 Frog   140 IYRSSCPVVVTYFPFDWQNCSMVFQSQTYSANEIELLLTVDEQTIEWIEIDPEAFTENGEWAIKH 204

  Fly   394 MSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVL--RS 456
            |....:.|   .|..|..:..:   .:.....:||...||:....:|.:......||.:.|  ::
 Frog   205 MPAKKIIN---HRLTPDDLNYQ---QIVFYLIIQRKPLFYIINIIVPCVLISFVSILVYFLPAKA 263

  Fly   457 TRRSSLILIALLIAAWGLMYMTRYASPH--YVPPMMTAYKVIMMTTTYCYILH-ICIIWLDLYPP 518
            ..:...:.|.:|:|....:::.....|.  ...|::..|...:|..|...:.: :.::.:.|..|
 Frog   264 GGQKCTVSINILLAQTVFLFLIAQKIPETSTAVPLIVKYLTFLMVVTITIVANAVIVLNISLRTP 328

  Fly   519 RSKAPGWLVRVINSNVLRCI-----LGLRFSDSTDYCDIQENPWHHMAKILNNLSSILVII 574
            .:.:....||.:   .||.:     :.||.||:..          .:|.::...||:.::|
 Frog   329 NTHSMSSTVREL---CLRTVPRLLRMHLRPSDAAP----------PLAPLMRRSSSVGLMI 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 45/229 (20%)
chrngNP_001096503.1 Neur_chan_LBD 21..235 CDD:308532 45/230 (20%)
Neur_chan_memb 242..486 CDD:308533 26/149 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.