DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrnb2

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001093684.1 Gene:chrnb2 XenbaseID:XB-GENE-854457 Length:499 Species:Xenopus tropicalis

Alignment Length:360 Identity:79/361 (22%)
Similarity:142/361 (39%) Gaps:73/361 (20%)


  Fly   217 EKLLSHLNIQAENASM--PANLSSISFHFQ-----TRSLAYEQTSSLLQTRMHMMMHWRDSRLVW 274
            |:|:.||...:....:  ||...|.....|     .:.::..:...::.|.:.:...|.|.||.|
 Frog    30 ERLVEHLLDPSRYNKLIRPATNGSEQVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTW 94

  Fly   275 KPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYAN------GSI-----TLY- 327
            .|.:|..::....|...||.|.:.:.|.| ..|      ||:..|:|      |||     .:| 
 Frog    95 DPAEFDDMKKVRLPSKHIWLPDVVLYNNA-DGM------YEVSFYSNAVVSHDGSIFWLPPAIYK 152

  Fly   328 -AQNLQLASW------CVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNT 385
             |..:::..:      |....|:|..:|...|:.|       :.:||.:.|            .|
 Frog   153 SACKIEVKHFPFDQQNCTMKFRSWTYDRTELDLVL-------RSDVASLDD------------FT 198

  Fly   386 PSG-WSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLI 449
            ||| |.       ::....:|..||.   .....|:..:|.::|...||.....:|.|......|
 Frog   199 PSGEWD-------IIALPGRRNENPN---DSTYVDITYDFIIRRKPLFYTINLIIPCILITSLAI 253

  Fly   450 LSFVLRST--RRSSLILIALLIAAWGLMYMTRYASPHYVP-PMMTAYKVI-MMTTTYCYILHICI 510
            |.|.|.|.  .:.:|.:..||.....|:.:::...|..:. |::..|.:. |:..|:..:..:|:
 Frog   254 LVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCV 318

  Fly   511 IWLDLY---PPRSKAPGWLVRVINSNVLRCILGLR 542
              |:::   |.....|.| |:|:..:.|..:|.::
 Frog   319 --LNVHHRSPTTHTMPPW-VKVVFLDKLPTLLFMK 350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 52/239 (22%)
chrnb2NP_001093684.1 Neur_chan_LBD 29..234 CDD:308532 52/240 (22%)
Neur_chan_memb 241..478 CDD:308533 25/114 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.