DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrnb1

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001240739.1 Gene:chrnb1 ZFINID:ZDB-GENE-070821-4 Length:492 Species:Danio rerio

Alignment Length:368 Identity:77/369 (21%)
Similarity:149/369 (40%) Gaps:51/369 (14%)


  Fly   197 CGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMP-----ANLSSISFHFQTRSLAYEQTSSL 256
            |...|.|:.......|:...:||.|..|.:...|..|     ..:..|...|.:.::..|:.:::
Zfish    11 CCLCGLGAMTGATEMEDKLMKKLFSAYNSKVRPARNPEERVVVRIGMILSSFVSLNMKDEEMNTI 75

  Fly   257 LQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYAN 321
            :.    |.:.|.|.||.|.|:|:|.::.......::|.|.:.::|......|..||.: :..|:|
Zfish    76 VM----MNLEWNDYRLSWNPKDYGGVDVLRISSGKVWLPDIVLINNNDGVFGVALQVH-VQAYSN 135

  Fly   322 GSIT-----LYAQNLQLA------SW--CVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQ 373
            |.:|     ||..:..:.      .|  |....|::..:....|::..|: :.|:|...:|.|  
Zfish   136 GRVTWTPPALYKSSCGVKVTYFPFDWQNCTMVFRSYTYDSSEVDLQHALD-KRGKEIKEIILD-- 197

  Fly   374 RKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFY 438
                         :|:|.:.      |...:.:.:.|.:.:.:..|:.....::|...||:....
Zfish   198 -------------TGFSESG------EWHIRHKVSRKNVREDLYEDITFYLIIERKPMFYVVNIV 243

  Fly   439 LPLIACQMFLILSFVL---RSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVI-MMT 499
            ||.|...:..|.:|.|   ...:....|.:.|.:..:.|:...:........|::..|.:| |:.
Zfish   244 LPCILITIIAIFNFYLPPDAGEKMGLSINVLLTLTVFLLLLANKIPETSLGVPIIVNYLMITMIL 308

  Fly   500 TTYCYILHICIIWLDLYPPRS-KAPGWLVRVINSNVLRCILGL 541
            .|:..||.:.::.|....|.: :.|.| ||.|..::|...||:
Zfish   309 VTFSVILSVVVLNLHHRSPNTHQMPLW-VRKIFIHMLPPYLGM 350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 46/235 (20%)
chrnb1NP_001240739.1 LIC 6..479 CDD:273305 77/369 (21%)
Neur_chan_LBD 26..235 CDD:280998 46/236 (19%)
Neur_chan_memb 242..478 CDD:280999 26/111 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.